KEGG   Ferroplasma acidarmanus: FACI_IFERC01G1351Help
Entry
FACI_IFERC01G1351 CDS       T02713                                 

Definition
(GenBank) hypothetical protein
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
fac  Ferroplasma acidarmanus
Pathway
fac00500  Starch and sucrose metabolism
fac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FACI_IFERC01G1351
Enzymes [BR:fac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     FACI_IFERC01G1351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 dCache_3
Motif
Other DBs
NCBI-ProteinID: AGO61331
UniProt: S0AQX3
LinkDB All DBs
Position
1321820..1322953
Genome map
AA seq 377 aa AA seqDB search
MENIAFYFELHQPLRLRPLKIQDRPDKMGIFWEEQNRDIFKRISEISYIPATKLLMESGI
KSTFSLSGTFIEQALKYSPETIDVIDDYVKSGLCELMGETYFHSLASIWNEDEFKYQVNE
QMHSIKSIFNYSPVSFRNTELIYNNRIAEMARDMGFRNILAEGTEEISRRYSPNFRYLSP
SGVNLYLRNYPMSDNISFRFSNTAWSGYPLTADKYIQWIQNSPGDIMNLYMDYETFGEHQ
RKETGIFDFVHYLGKYIEQYGMETLKIDEIQAKFSVKDTVSIDKTISWADTRRDLSAWLG
NKMQNEAFSRLKHCEDCPDKKLWRYLQTSDLIYYMSMGEPEDFTVHEYFNPYRSPYLAFI
YYMYALDNVCENAGKQL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatagccttttactttgaactgcaccagcccttaaggcttcgcccattaaaa
atacaggacaggcctgataagatgggcatattctgggaagaacagaacagggatattttt
aagagaatatcagaaatttcttacatcccagcaacaaaacttttaatggaaagcgggatt
aaatcaacattttccctgtcagggacgtttattgaacaggcattgaaatacagccctgaa
actatagatgttatagatgactatgtaaaatcaggattgtgtgaactgatgggagaaaca
tatttccattcccttgcttcaatctggaatgaagatgaatttaaataccaggtaaatgaa
cagatgcattcaataaaaagcatctttaattattcccctgtgtcattcaggaatacggaa
ctcatatacaataacaggattgcagagatggccagggatatgggcttccggaatatcctg
gcggagggcacagaagaaatctcaaggcgttatagccctaatttcaggtatttatcccca
tccggtgtaaacctctaccttagaaattatcctatgagtgataatatttcgttcagattt
tccaacactgcctggagcgggtatccactgacagcagacaaatacattcaatggattcaa
aatagcccgggagatataatgaacctttacatggactatgagactttcggcgaacaccag
agaaaggaaacgggcatattcgatttcgtccactacctgggaaaatatatcgagcaatat
ggcatggaaaccctgaagattgatgaaatacaggcaaaatttagcgtgaaggatacagtc
agcattgacaaaacaatttcctgggcggatacaaggagagacctctctgcctggctcggg
aataaaatgcagaatgaagcatttagccggctaaagcactgtgaagattgcccggataaa
aaactgtggagatacctccagacttcagatcttatatactatatgtccatgggagagccg
gaagattttacagtgcacgaatattttaatccataccggtcgccataccttgccttcatt
tattatatgtacgcacttgataacgtatgcgaaaatgctggaaaacaactgtaa

DBGET integrated database retrieval system