KEGG   Fibrella aestuarina: FAES_0429Help
Entry
FAES_0429         CDS       T02429                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fae  Fibrella aestuarina
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FAES_0429
   00030 Pentose phosphate pathway
    FAES_0429
   00051 Fructose and mannose metabolism
    FAES_0429
   00052 Galactose metabolism
    FAES_0429
  Energy metabolism
   00680 Methane metabolism
    FAES_0429
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    FAES_0429
Enzymes [BR:fae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FAES_0429
Protein phosphatases and associated proteins [BR:fae01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FAES_0429
Messenger RNA biogenesis [BR:fae03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     FAES_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(552114..553088)
Genome map
AA seq 324 aa AA seqDB search
MKRIAVFTSGGDAPGMNACIRAVVRGAVYHDIEVFGIRRGYNGMINGDIFQMTSHSVSNI
VQRGGTILKSARSKEFMTPEGRQRAHEQLQKFGIEGLVAIGGNGTFTGATLFFDEFGIPT
VGAPGTIDNDLYGTDYTIGFDTAVNTALEAIDKIRDTADSHDRIFLIEVMGRDSGYIAIQ
SGIAGGAELVMVPEVLTPISEVVKTLQAGFNRSKSSSIVVVAEGEEEGSAAEVAEKISKL
IEGELDMRVTTLGHIQRGGIPTAYDRILASRLGLGALEGLLNGEKNVMAGVINNELVYTP
FRDTIRLPKPINEDLLRMVKILSV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgtgtttacctctgggggagacgcaccgggcatgaacgcctgcatt
cgggcagttgtgcgcggagccgtttaccacgatattgaagtgttcggtatccgccggggg
tataacgggatgatcaatggcgacatctttcagatgacctctcactcggtgagcaacatc
gtgcagcggggtggtaccatcctgaaatcggcccgcagcaaggagttcatgacccccgaa
gggcggcagcgcgcccacgaacaattgcagaagttcggcattgaaggtcttgtcgctatt
ggcggtaatggtacgttcaccggtgctacgctcttcttcgacgagttcggtatcccgacg
gttggtgcacccggcaccattgataacgacctctacggtactgactataccattggcttc
gacacggcggtgaacacggccctggaagccatcgataaaattcgtgatactgccgactcc
cacgaccggatcttcctgatcgaggtgatgggccgcgactcgggctatatcgctatccaa
tcggggattgcgggtggtgctgagctggtgatggtgcccgaagtgctgacgcccatctcc
gaagtcgtgaaaacgcttcaggcgggttttaaccgcagtaaatcgtcgtcgattgtagtt
gtggctgaaggcgaagaggagggaagtgccgccgaagtagccgagaaaatcagcaagctg
attgaaggcgaactggacatgcgcgtgaccaccctgggccacattcagcgcggcggtatt
ccaacggcctacgaccgcattctggcaagccggttggggctgggtgcgctggaaggccta
ctcaatggcgagaagaacgtaatggcgggtgtaatcaacaacgaactagtctacacgccg
ttccgcgacaccatccggttgcccaaaccgatcaatgaagacctgctcaggatggtgaaa
atcctgagcgtttag

DBGET integrated database retrieval system