KEGG   Flammeovirgaceae bacterium 311: D770_23730Help
Entry
D770_23730        CDS       T04058                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
fbt  Flammeovirgaceae bacterium 311
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:fbt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D770_23730
   00052 Galactose metabolism
    D770_23730
Enzymes [BR:fbt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     D770_23730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5742850..5744040
Genome map
AA seq 396 aa AA seqDB search
MIKSNAQQKLQNFFMLGLLVAGWACSGSPQQEEGEQTQPITINNMKVEKQDFGTTKEGTP
VDLYVLTNSRGVIAKITNYGGIITSLILPDKNGKMEDVVLGFDSLSGYLQEDVPYFGAII
GRYGNRIAKGKFSLDGQEYTLARNNGPNTLHGGAQGFDKRVWQAEEVRNDQGVGVKMRYV
SPDGEEGYPGTLTSDVVYTLTDDNELIIEYTATTDKPTVVNLTNHSYFNFTGNTKRDILD
HQVMISADKFVPVDGDLIPTGQLQDVAGTPMDFSKPIPVGQNINSDHEQIRLGGGYDHTW
VLGEPGEMKLAATVYEPTTGRYMEVHTTEPGVQFYTGNFLKGQLVGKGDVAYQYRYGLCL
ETQHFPDSPNQPDFPSVELRPGETYTTKTVHKFAVK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgattaaatccaatgcgcagcagaagttgcaaaacttttttatgctcggtctgctggtg
gcaggctgggcctgctccggctctccccagcaagaggagggtgagcaaacacagcctata
acaataaataatatgaaagttgagaaacaagatttcggtactactaaagaaggaactccc
gtagatttgtatgtgctgaccaacagcaggggtgtcatcgctaaaattaccaactatggc
ggcattatcacttcactgatcttaccagacaaaaacggtaagatggaagatgtagtcctg
ggctttgattctttatcgggctacctgcaggaggatgtgccttactttggtgccattata
ggccgctatggtaaccgtattgcaaagggaaaattttcactggatgggcaggagtatacg
cttgccagaaataacggaccaaacacactgcatggaggtgcgcagggttttgacaaacgg
gtatggcaggcagaggaagtacgtaacgatcagggcgtgggcgtaaagatgcgctatgtg
agtcctgatggagaagagggctatcccggcacacttacttcagatgtggtatatacttta
acagacgataatgagctgattattgaatacaccgccactaccgataaaccaacagttgta
aacctgaccaaccactcttattttaactttaccggcaatacaaaaagagatattctggac
caccaggttatgatcagcgccgataaatttgttcctgtggatggtgatctgattcccacc
ggacaacttcaggatgtggcgggtacacccatggacttttcaaaaccaatacctgttggg
cagaacattaactctgaccatgagcagatcaggctgggaggaggctacgaccatacctgg
gtgctgggtgaaccaggtgaaatgaagcttgctgctacagtttatgagcctaccaccgga
cgctacatggaggtgcataccacagagccaggtgtacagttttacaccggcaactttctg
aagggacaattagttggtaaaggtgatgtggcctaccagtaccgctacggtctgtgcctt
gaaacacaacattttccagattcacctaaccagcccgatttcccatcggtagagctgcgc
cccggagaaacctacaccactaaaaccgtgcataagtttgcagtaaagtag

DBGET integrated database retrieval system