KEGG   Felis catus (domestic cat): 100126581Help
Entry
100126581         CDS       T02385                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2 precursor
  KO
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Arachidonic acid metabolism
Metabolic pathways
NF-kappa B signaling pathway
VEGF signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Retrograde endocannabinoid signaling
Serotonergic synapse
Ovarian steroidogenesis
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Leishmaniasis
Human papillomavirus infection
Kaposi's sarcoma-associated herpesvirus infection
Pathways in cancer
Chemical carcinogenesis
MicroRNAs in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100126581 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100126581 (PTGS2)
   04064 NF-kappa B signaling pathway
    100126581 (PTGS2)
   04668 TNF signaling pathway
    100126581 (PTGS2)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    100126581 (PTGS2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100126581 (PTGS2)
   04913 Ovarian Steroidogenesis
    100126581 (PTGS2)
   04921 Oxytocin signaling pathway
    100126581 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    100126581 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    100126581 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100126581 (PTGS2)
   05206 MicroRNAs in cancer
    100126581 (PTGS2)
   05204 Chemical carcinogenesis
    100126581 (PTGS2)
   05222 Small cell lung cancer
    100126581 (PTGS2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100126581 (PTGS2)
   05165 Human papillomavirus infection
    100126581 (PTGS2)
   05140 Leishmaniasis
    100126581 (PTGS2)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100126581 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
F1
AA seq 604 aa AA seqDB search
MLARALLLCAALALCRAANPCCSNPCQNQGVCLSIGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYKLTHFKGVWNIVNNIPFLQNIIMKYVLTSRSHLIESPPTYNVDY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLSHVYGETLDRQHKLRLFKDGKMKY
QIIDGEVYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLIMIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTLQIDDQEYNFQQFVYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAVQQVAKASIDQSRQMKYQSLNEYRKRFRLKPYTSFEELTGEKEMAAGLEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcccgcgccctgctgctctgcgccgccctggcgctctgccgtgcagcaaatcct
tgctgttccaacccatgccaaaaccaaggtgtatgcctgagcataggatttgaccagtat
aagtgtgactgtacccgaacaggattctatggtgaaaactgttcaacacctgaatttctg
acaagaataaagttattcctgaaacccactccaaatacagtgcactacaaacttacccac
ttcaagggagtctggaacattgtcaataacattcccttcctgcaaaatataattatgaaa
tatgtgttgacatccaggtcacatttgatcgagagcccaccaacttacaatgtggactat
ggctataaaagctgggaagccttttccaatctctcctattataccagagctcttccccct
gtggctgatgactgcccaacacccatgggtgtgaaaggcaagaaagagcttcctgattca
aaagagattgtggaaaaatttcttctaagaagaaagttcattcctgacccccaaggcaca
aatatgatgtttgcattttttgcccaacacttcacccatcaatttttcaagacagatcat
aagcgaggaccagctttcaccaaaggactgggccatggggtggacttaagtcatgtttat
ggtgaaactttggatagacagcataaactgcgccttttcaaggatggaaaaatgaaatac
cagataatcgatggggaggtgtatcctcccacagtcaaagatactcaggtcgagatgatc
tacccacctcatgttcctgaacacctgcggtttgctgtgggccaggaggtctttggtctg
gtgcctggtctgatgatgtacgccacaatttggctgcgggaacacaacagagtgtgtgat
gtgcttaaacaggagcatccagaatgggatgatgagcggttgttccagacgagcaggcta
ataatgataggagaaaccattaagattgtgattgaagactatgtacaacacttgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacaattccaataccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttctgcctgacacc
ttgcaaatagatgaccaggagtacaatttccagcagtttgtctacaacaactctatatta
ctggaacatgggcttacccagttcgtggaatcattcagcaggcaaattgctggcagggtt
gctggtggtaggaatgttccagctgcagtgcagcaagtagcaaaggcctcaatcgaccag
agcagacagatgaagtaccagtctcttaatgagtatcgcaaacgctttcggctgaagccc
tatacatcgtttgaagaactcacaggagagaaggaaatggctgcggggttagaagcactt
tatggtgatattgatgccatggagctgtatcctgcccttctggtagaaaagcctcgccct
gatgccatctttggtgagaccatggtagaaatgggagcaccattctccttgaaaggactt
atgggtaatcctatatgttctcctgactactggaagcctagcacttttggtggagaagta
ggttttaaaatcatcaacactgcctcgattcagtctctcatctgcaataacgtgaagggc
tgtccttttactgcattcagtgttcaagatccacagctcaccaaaacagtcaccattaat
gcaagctcttcgcactctggactggatgatatcaatcccacagtactgctaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system