Felis catus (domestic cat): 100127112 Help Entry 100127112         CDS       T02385                                  Symbol MCP-1 Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04061   Viral protein interaction with cytokine and cytokine receptor fca04062   Chemokine signaling pathway fca04621   NOD-like receptor signaling pathway fca04657   IL-17 signaling pathway fca04668   TNF signaling pathway fca04933   AGE-RAGE signaling pathway in diabetic complications fca05135   Yersinia infection fca05142   Chagas disease fca05144   Malaria fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05168   Herpes simplex virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05323   Rheumatoid arthritis fca05417   Lipid and atherosclerosis fca05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     100127112 (MCP-1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100127112 (MCP-1)    04061 Viral protein interaction with cytokine and cytokine receptor     100127112 (MCP-1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100127112 (MCP-1)    04657 IL-17 signaling pathway     100127112 (MCP-1)    04062 Chemokine signaling pathway     100127112 (MCP-1)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100127112 (MCP-1)    05164 Influenza A     100127112 (MCP-1)    05168 Herpes simplex virus 1 infection     100127112 (MCP-1)    05163 Human cytomegalovirus infection     100127112 (MCP-1)   09171 Infectious disease: bacterial    05135 Yersinia infection     100127112 (MCP-1)   09174 Infectious disease: parasitic    05144 Malaria     100127112 (MCP-1)    05142 Chagas disease     100127112 (MCP-1)   09163 Immune disease    05323 Rheumatoid arthritis     100127112 (MCP-1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100127112 (MCP-1)    05418 Fluid shear stress and atherosclerosis     100127112 (MCP-1)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100127112 (MCP-1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fca04052]     100127112 (MCP-1)    00536 Glycosaminoglycan binding proteins [BR:fca00536]     100127112 (MCP-1) Cytokines and neuropeptides [BR:fca04052]  Cytokines   Chemokines    100127112 (MCP-1) Glycosaminoglycan binding proteins [BR:fca00536]  Heparan sulfate / Heparin   Chemokines    100127112 (MCP-1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  100127112 NCBI-ProteinID:  XP_003996605 EnsemblRapid:  ENSFCTG00005027669 UniProt:  M3VVI4 LinkDB All DBs Position E1:22033241..22035140 Genome browser AA seq 99 aa AA seqDB search MKVSAALLCLLLTAAAFSLQVLAQPDAINSPVTCCYTLTNKKISMQRLVSYKRVTSSKCP KEAVIFKTILNKEICADPNQKWVKDSMAHLDKKTQTAKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagcgcttctgtgcctgctgctcacagctgctgccttcagcctccag gtgctcgcccagccagatgcaattaattctccagtcacctgctgctatacactcaccaat aagaagatctcgatgcagaggctggtgagctataaaagagtcaccagcagcaagtgtccc aaagaagctgtgatcttcaagaccatcctaaacaaggagatctgcgctgacccaaaccag aagtgggtcaaggattccatggcacacctggacaagaagacccaaactgcaaagccttga

DBGET integrated database retrieval system