KEGG   Felis catus (domestic cat): 101080534Help
Entry
101080534         CDS       T02385                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
fca  Felis catus (domestic cat)
Pathway
Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    101080534 (F13A1)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101080534 (F13A1)
Cell adhesion molecules and their ligands [BR:fca04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     101080534 (F13A1)
   VLA-9
     101080534 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
B2
AA seq 732 aa AA seqDB search
MSETSAPALGGRRALPRNASNAAEDDLPTVELQGLTPRGFNLQDYLNVTNVHLFKERWDS
NKVDHHTDKYENNHLIVRRGQSFFIQIDFNRPYDPRKDFFRVEYVIGRYPQENKGTYIPV
PVVSQLQKGKWGAKVVMREDRSVRLSIQSSPECIVGKFRMYVAVWTPYGVLRTSRNPETD
TYILFNPWCEEDAVYLDDDKEREEYVLNDIGVIFYGDFNDIKTRSWSYGQFEDGILDACL
YVMDRAEMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL
LEYQSTKNPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNDANLQMDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRSDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHICFQFDAPFVFAEVNSDLIYITVKKDGTHVVENVDTTHIGKLIVTKEVGGDGIRDITD
TYKFQEGQEEERLALETALMYGAKKSLNTEGIVKPRSDVDMDFEVEKAVLGRDFKLTITF
QNNSPNRYTLSAYLSGNIVFYTGVSKTEFKKETFEVTLEPMSFKKEEVLIRAGEYMSQLL
EQGFLHFFVTARVSETRDVLAKQKSTVLAIPKLIIKVRGTRMVGSDMVVTVEFTNPLKET
LRNVWIYLDGPGVTKPMRKMFREIRPNSTVQWEEVCRPWVSGPRKLIASMTSDSLRHVYG
ELELQIQRRPSV
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagacctccgcacctgcacttggaggcaggcgagccctgccccgaaacgcctcc
aatgcggcagaggatgacctccccactgtggagctgcaggggctgaccccccggggcttc
aacctgcaagactaccttaatgtcacaaatgttcacctgttcaaggagagatgggacagc
aacaaagtggaccaccacactgacaagtatgaaaacaaccacctgattgtacgtagagga
cagtctttcttcattcagattgacttcaatcgtccatacgaccccagaaaggatttcttc
agagtggaatatgtcattggtcgctaccctcaggagaacaagggaacctacatcccagtt
cctgtcgtctcacagctgcagaaaggcaagtggggggccaaagttgtcatgagagaggac
aggtctgtccggctgtccatccagtcttctccagagtgcattgtggggaaattccgcatg
tatgttgctgtctggaccccctacggcgttctccgcaccagccgaaacccagaaacagac
acatacattctcttcaatccttggtgtgaagaggatgctgtgtatctggatgatgataaa
gaaagagaagagtatgtcctgaatgacatcggggttatattttatggagacttcaatgac
atcaagactagaagctggagctatggtcagtttgaggatggcatccttgatgcttgcctg
tatgtgatggatagagcagaaatggacctttctggtagagggaatcccatcaaggtcagc
cgtgttggatctgcaatggttaatgccaaagatgatgaaggtgtccttgttggatcctgg
gacaacatctatgcctatggtgtccccccatcagcctggaccggaagcgttgacattctg
ttggaataccagagtactaagaatccagtccggtatggtcagtgctgggtttttgctggt
gtctttaacacatttttgcgatgccttgggataccagcgagagttgttaccaattatttc
tcagcccatgataatgatgccaatttgcaaatggacatcttcctggaagaagatgggaac
gtgaactccaaactcaccaaggattcggtgtggaactaccactgctggaatgaagcctgg
atgacaaggtctgatcttcctgttggatttggaggttggcaagccgtggacagcaccccc
caggaaaacagtgatgggatgtatcggtgtggtccagcctctgttcaagccattaagcac
ggtcatatttgcttccagtttgatgcaccctttgtttttgcagaggtcaacagtgatctc
atttacattacagtcaagaaagatggcactcatgtggttgaaaacgttgataccacccac
attgggaaattaattgtgaccaaagaagttggaggagatggcataagggatattactgat
acctacaaattccaagaaggccaagaagaagagaggctggctctagaaactgcactgatg
tatggggctaaaaagtccctcaacacagaaggcattgtcaaaccaaggtctgacgtggac
atggattttgaagtggagaaagccgtgctgggaagagacttcaagctcaccatcaccttc
cagaacaacagccccaaccgttacaccctttcagcctatctctcaggcaacattgtcttc
tacacgggagtctccaagacagaattcaagaaggagacatttgaagtgacgctggagccc
atgtccttcaagaaagaggaagtgctgatcagagcaggcgagtacatgagccagctgcta
gagcaagggttcctgcacttctttgtcacagcgcgtgtcagtgagaccagggacgttctg
gccaagcagaaatccaccgtgctggcgatccccaagctcatcatcaaggtccgcggcact
aggatggttggttctgacatggtggtgacagttgaattcaccaatcctctaaaagaaact
ctgcgaaatgtttggatatacctggatggtcctggagtgacaaaaccaatgaggaagatg
ttccgtgaaatccggcccaactccactgtgcaatgggaagaagtttgtcgaccctgggtg
tctggccctcggaagctgatagctagcatgaccagtgactccctgagacacgtgtatggc
gagctggagttgcagattcagagacgaccttctgtgtaa

DBGET integrated database retrieval system