KEGG   Francisella cf. novicida Fx1: FNFX1_1742Help
Entry
FNFX1_1742        CDS       T01937                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    FNFX1_1742
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FNFX1_1742
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FNFX1_1742
   00430 Taurine and hypotaurine metabolism
    FNFX1_1742
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    FNFX1_1742
Enzymes [BR:fcf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FNFX1_1742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1825198..1826544)
Genome map
AA seq 448 aa AA seqDB search
MALHGKKDTINNLDFFEQSLPKFKLPLNSQDPLEVYQEIKDELMLDGNSKQNLATFCQTE
VDDFIHKLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAENAIGCSTTSSSEAA
MLGGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSNESLIMT
PEAVLERCDENTIGVVPTLGVTFTGQYEPVEQVCKALDDFERQTGIDIPVHVDAASGGFL
APFVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVIWADKKYLPDDLIFNVNYLGGNM
PTFALNFSRPGGQIVAQYYNFVRLGLEGYKKVHQLCYDVAKYIAKELRKMEIFEIIHAGE
GGIPAVSWSLKATKEYSLFDISEKVRAKGWQIAAYTMPNNREDLVVMRVLVRRGFSYDLA
QLMIRDLVAVIDSLEGKLKILKRSSFAH
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcattacatggtaaaaaagatacaattaataaccttgatttttttgaacaatcttta
ccaaagtttaaacttccactaaattcacaagatcctttagaagtgtatcaagaaatcaaa
gatgagttaatgctagatggtaattcgaagcaaaatttagcgacgttttgccaaacggaa
gttgatgatttcattcacaagcttatggatgattgcattgataaaaatatgattgacaaa
gatgaatatccgcagactgcggaaatagagtctcgctgtgtaaatatcctggcaaaccta
tggaactcttcagcagaaaatgcaattggctgctcaacgactagctcatcagaggctgct
atgcttggcggtatggcaatgaagtggcgttggcgagataaaatgaaagcgcaaggtaaa
gattatacaaagcctaatcttgttacaggacctgtgcaagtgtgctggcataaatttgct
agatattgggatattgagcttagagaaattccaatgtcgaatgaaagtttaataatgact
ccggaggctgtgcttgaaagatgtgatgaaaatacaatcggtgtggtgccaactcttgga
gtgacttttacagggcagtatgagccagtagaacaggtatgtaaagctcttgatgatttt
gaacgacaaacaggcatagatattccagttcatgttgatgcagcatctggaggttttttg
gcaccatttgtagagcctgaacttaagtgggactttagattaccaagagttaagtcaatt
aactcatcaggacataagtttggcttatcgccacttggggttggttgggttatttgggct
gataaaaagtacttaccagatgatttgatttttaatgttaattacctaggtggtaatatg
ccaacatttgcattgaatttctcgcgacctggtggtcagatagtagctcagtattataat
tttgttaggttaggtttagaaggctataagaaagttcatcagctttgctatgatgttgca
aaatatattgctaaagagcttagaaaaatggaaatttttgaaattattcatgctggagag
ggtggtattcctgcagttagctggtcacttaaagcaactaaagagtacagtttgtttgat
atatctgagaaagttcgcgctaaaggttggcaaatagcagcttacacaatgccaaataat
cgtgaagatttagtggttatgcgtgtgttagttagaagaggctttagttatgacttggca
cagttgatgattagagatttagttgcggtgattgattcattagagggaaagttaaaaata
ttaaaaaggagtagttttgcgcattag

DBGET integrated database retrieval system