KEGG   Francisella cf. novicida Fx1: FNFX1_1742Help
Entry
FNFX1_1742        CDS       T01937                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
fcf00250  Alanine, aspartate and glutamate metabolism
fcf00410  beta-Alanine metabolism
fcf00430  Taurine and hypotaurine metabolism
fcf00650  Butanoate metabolism
fcf01100  Metabolic pathways
fcf01110  Biosynthesis of secondary metabolites
fcf01120  Microbial metabolism in diverse environments
fcf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    FNFX1_1742
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FNFX1_1742
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FNFX1_1742
   00430 Taurine and hypotaurine metabolism
    FNFX1_1742
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    FNFX1_1742
Enzymes [BR:fcf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FNFX1_1742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AEE88127
LinkDB All DBs
Position
complement(1825198..1826544)
Genome map
AA seq 448 aa AA seqDB search
MALHGKKDTINNLDFFEQSLPKFKLPLNSQDPLEVYQEIKDELMLDGNSKQNLATFCQTE
VDDFIHKLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAENAIGCSTTSSSEAA
MLGGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSNESLIMT
PEAVLERCDENTIGVVPTLGVTFTGQYEPVEQVCKALDDFERQTGIDIPVHVDAASGGFL
APFVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVIWADKKYLPDDLIFNVNYLGGNM
PTFALNFSRPGGQIVAQYYNFVRLGLEGYKKVHQLCYDVAKYIAKELRKMEIFEIIHAGE
GGIPAVSWSLKATKEYSLFDISEKVRAKGWQIAAYTMPNNREDLVVMRVLVRRGFSYDLA
QLMIRDLVAVIDSLEGKLKILKRSSFAH
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcattacatggtaaaaaagatacaattaataaccttgatttttttgaacaatcttta
ccaaagtttaaacttccactaaattcacaagatcctttagaagtgtatcaagaaatcaaa
gatgagttaatgctagatggtaattcgaagcaaaatttagcgacgttttgccaaacggaa
gttgatgatttcattcacaagcttatggatgattgcattgataaaaatatgattgacaaa
gatgaatatccgcagactgcggaaatagagtctcgctgtgtaaatatcctggcaaaccta
tggaactcttcagcagaaaatgcaattggctgctcaacgactagctcatcagaggctgct
atgcttggcggtatggcaatgaagtggcgttggcgagataaaatgaaagcgcaaggtaaa
gattatacaaagcctaatcttgttacaggacctgtgcaagtgtgctggcataaatttgct
agatattgggatattgagcttagagaaattccaatgtcgaatgaaagtttaataatgact
ccggaggctgtgcttgaaagatgtgatgaaaatacaatcggtgtggtgccaactcttgga
gtgacttttacagggcagtatgagccagtagaacaggtatgtaaagctcttgatgatttt
gaacgacaaacaggcatagatattccagttcatgttgatgcagcatctggaggttttttg
gcaccatttgtagagcctgaacttaagtgggactttagattaccaagagttaagtcaatt
aactcatcaggacataagtttggcttatcgccacttggggttggttgggttatttgggct
gataaaaagtacttaccagatgatttgatttttaatgttaattacctaggtggtaatatg
ccaacatttgcattgaatttctcgcgacctggtggtcagatagtagctcagtattataat
tttgttaggttaggtttagaaggctataagaaagttcatcagctttgctatgatgttgca
aaatatattgctaaagagcttagaaaaatggaaatttttgaaattattcatgctggagag
ggtggtattcctgcagttagctggtcacttaaagcaactaaagagtacagtttgtttgat
atatctgagaaagttcgcgctaaaggttggcaaatagcagcttacacaatgccaaataat
cgtgaagatttagtggttatgcgtgtgttagttagaagaggctttagttatgacttggca
cagttgatgattagagatttagttgcggtgattgattcattagagggaaagttaaaaata
ttaaaaaggagtagttttgcgcattag

DBGET integrated database retrieval system