KEGG   Falco cherrug (Saker falcon): 102048145Help
Entry
102048145         CDS       T02911                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
fch  Falco cherrug (Saker falcon)
Brite
Enzymes [BR:fch01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102048145 (ACE)
Peptidases [BR:fch01002]
 Metallo Peptidases
  Family M2
   102048145 (ACE)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102048145 (ACE)
CD molecules [BR:fch04090]
 Proteins
  102048145 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1281 aa AA seqDB search
MPPALGLLLGLSLVGALQPGLEPPQHDPTEEGAALFASAYNSTAELVLFNSVSASWNYYT
NLTTENAALQVNASLEEQNFMELWGKKAKDLFGSIWSNFSDPQLKKIISSIQTLGPSNLP
LEKREQYNTILSDMDKIYSTAKVCLANGTCWELEPDISDIMASSRSYKKLLYAWEGWHNA
AGNPLRAKYEEFVKLSNEAYQPDGFEDTGSYWRSWYDSVSFEDDLEHLYHQLEPLYLNLH
AFVRRKLYDRYGPKYINLKGPIPAHLLGNMWAQQWNNIYDLMVPYPEKPNLDVTSTMVQQ
GWNATHMFRVSEDFFTSLGLLEMPPEFWEKSMLEKPMDGREVVCHASAWDFYNRKDFRIK
QCTMVTMEQLFTVHHEMGHVQYYLQYKDQPVSFRSGANPGFHEAIGDVLSLSVSTPSHLK
KIGLLSSATEDKESNINYLLKMALEKIAFLPFGYLIDQWRWNVFSGRTPPNRYNYDWWYL
RTKYQGICAPISRNESNFDPGAKYHIPGNTPYIRYFVSFVLQFQFHKALCQAAKHNGSLH
TCDIYMSKEAGDKLREVLKAGSSKPWQEILFNLTGTDKMDAGALLEYFSPVTEWLQEQNN
KTNEVLGWPEFDWRPPIPEGYPEGIDKIADEAQAKEFLSEYNSTAEAVWNAYTEASWAYN
TNITNHNKEIMLDKNLAMSKHTLEYAMRARQFDPSDFQDQSVTRILKKLSVIERAALPEN
ELKEYNALLSDMETTYSVAKVCRENKTCHPLDPDLTDIMATSRDYDELLFAWKGWRDASG
KKIKNNYKRYVELSNKAAMLNGYTDNGAFWRSLYETPTFQEDLERLYLQLQPLYLNLHAY
VRRALYKKYGAERINLRGPIPAHLLGNMWAQSWSNIFDLLIPFPDATKVDATPAMKQQGW
TPKKMFEESDRFFTSLGLIPMPQEFWDKSMIEKPADGREVVCHASAWDFYNRKDFRIKQC
TVVNMDDLITVHHEMGHVQYFLQYMDQPISFRDGANPGFHEAVGDVMALSVSTPKHLHSI
NLLDQVTENKESDINYLMNMALDKIAFLPFGYLMDQWRWKVFDGQIKEDEYNQEWWNLRM
KYQGLCPPTPRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCAAAGHTGPLHMC
DIYQSKEAGRILGEALKLGFSKPWPKAMELITGQPNMSADALMSYFEPLMTWLVNENKKN
GEVLGWPEYGWTPYTATPAQASSDHQTDFLGMSLTSNQATAGAWVLLALALAFLITTIFL
GVKFFSARRKTFKSSSEMELK
NT seq 3846 nt NT seq  +upstreamnt  +downstreamnt
atgcccccggcgctggggctgctgctggggctgagcctggtgggtgcccttcagccgggg
ctcgagcccccccagcatgaccccaccgaggaaggggctgccctctttgccagcgcctac
aacagcaccgctgagctcgtcctcttcaacagcgtctcggccagctggaattactacacc
aacctgacaactgaaaacgcagctctgcaggtcaacgcatcgctggaggagcaaaacttc
atggagctgtgggggaagaaagccaaggacctctttggcagcatctggagcaacttcagt
gatccacagctgaagaaaattatcagttccatccagaccctgggaccctccaacttgccc
ctggagaagagagagcagtacaacaccatcctgagtgacatggacaaaatctactccaca
gccaaggtgtgcctggccaacggtacctgctgggagctggagccagacatctcagacatc
atggcctcctcccgcagctacaagaagctgctctacgcctgggagggctggcacaacgcc
gcaggcaacccactgcgtgccaagtatgaggaattcgtgaagctgagcaacgaggcctat
caaccggatggatttgaggacacaggcagctactggcgctcctggtacgactcagtctcc
ttcgaggatgacctggagcatctctaccaccagctggagccactctacctcaacctgcac
gcctttgtccggaggaagctgtacgatcgctatggccccaaatacatcaacctgaagggt
cctatccctgctcacctcctgggcaacatgtgggctcagcagtggaacaacatctatgac
ctgatggtcccctaccctgagaagcccaacctcgatgtcacgagcaccatggtgcagcag
ggctggaatgccacccacatgttccgggtatcggaggacttcttcacctccctgggactg
ctggagatgccccctgaattttgggagaagtccatgctggagaagccaatggatgggcgg
gaggtggtatgtcatgcctcagcctgggacttctacaaccgcaaggacttcaggatcaag
caatgcacaatggtgaccatggagcagctgttcacggtgcaccacgagatgggccacgtc
caatactacctgcagtacaaggaccagcccgtctccttccgcagcggggccaaccctggc
ttccatgaggccatcggcgatgtcctctccctgtctgtctccacccccagccacctcaag
aagattggtctcctcagcagtgccaccgaggacaaagagagcaacatcaactacctgctg
aagatggccttggagaagatcgccttcctgccctttggctacctcatcgaccagtggcgc
tggaacgtgttcagcggccgcacaccccccaaccgttacaactacgactggtggtacctg
agaaccaaataccagggtatttgtgctccgatttcaaggaatgaaagcaactttgaccct
ggagcaaagtaccacatccctgggaacaccccttacatcaggtactttgtgagcttcgtc
cttcagttccagtttcacaaggccctgtgtcaggcagccaagcacaacggttccctgcac
acctgtgacatctacatgtccaaagaggctggagacaaactcagggaagtgttgaaagct
ggatcttccaagccgtggcaggaaatcctgttcaacctcaccggcacggataagatggat
gctggggcgctcctggagtacttcagccctgtcactgagtggcttcaggagcagaacaac
aagaccaatgaggtgctgggctggcctgagtttgactggcgtccccctatccctgaaggc
taccctgaaggcattgacaaaatagcagatgaagcacaagcaaaagagttcttgtctgag
tacaacagcacggcggaggcagtgtggaacgcctacaccgaggcatcctgggcctacaac
accaacatcaccaaccacaacaaggagattatgctggataagaacttagccatgtccaag
cacacccttgagtacgccatgagggccaggcagttcgacccctctgatttccaggaccaa
agtgtcacgcgcatcctcaagaagctgagtgtcattgagagggcagccctgcctgagaac
gagctgaaggagtataacgccctcctctcagatatggagaccacatacagtgtagccaag
gtctgcagagagaacaaaacctgtcacccactggatcctgacctcacagacatcatggcc
acctcacgggactatgatgagctcctctttgcctggaaaggctggcgggatgcttctggg
aagaagatcaagaacaactacaagcgatacgtggaactgagcaacaaggcagccatgctc
aatggctacacagacaatggggccttctggagatccctgtatgagacacccaccttccag
gaagatctggagaggttgtacctacagctgcagcccctgtacctcaacttgcatgcctac
gtacgccgagccctgtacaaaaagtatggtgcagagcgtataaacctgaggggtcccatc
cctgctcatttgctaggcaacatgtgggcccagtcatggtccaacattttcgacctgctg
atacccttcccggatgccaccaaggtggatgccaccccagccatgaaacaacagggctgg
acacccaagaagatgtttgaagagtcagaccgtttctttacctctctgggcctcatcccc
atgccgcaggagttctgggacaagtccatgatcgagaagccagcagatgggcgagaggtg
gtgtgtcatgcctcagcctgggacttctacaaccgcaaggacttcaggatcaagcagtgc
accgtggtgaacatggacgacctaatcacggtgcaccacgagatgggccacgtccagtac
ttcctgcagtacatggaccagcccatctcattccgtgatggggccaaccctggcttccac
gaggctgttggggatgtcatggccttgtccgtctccacccccaaacacctgcacagcatc
aatctgctggaccaagtcacagaaaataaagaaagtgacattaactacctgatgaacatg
gccctggacaaaatcgccttcctgccctttggatacctcatggaccagtggcgctggaag
gtgtttgatggacagatcaaggaggacgagtacaaccaggagtggtggaacctcaggatg
aagtaccagggcttgtgcccaccaacaccaaggtctgaagatgactttgatcccggagca
aagtttcacatccctgccaacgtcccctacatcaggtactttgtcagcttcgtcatccag
ttccagttccaccaggcactctgtgcagcagctgggcacacgggtcccctgcacatgtgt
gacatctaccagtccaaggaggctgggaggatcttgggggaagccctgaagctgggtttc
agcaagccgtggcccaaagccatggagctcatcacggggcagcccaacatgtcagctgac
gccctgatgagctactttgagccgctcatgacatggttggtgaatgagaacaagaagaac
ggagaggtcctgggctggcccgaatatggctggactccttacacagctactccagcccaa
gccagctctgaccaccaaactgatttcctgggcatgtccctgaccagcaatcaagccaca
gcaggtgcctgggtcctgcttgccctggcacttgccttcctgatcaccaccatcttcttg
ggtgtcaagttcttctcagccaggagaaagaccttcaaatccagctcagaaatggaactg
aaataa

DBGET integrated database retrieval system