KEGG   Falco cherrug (Saker falcon): 102050236Help
Entry
102050236         CDS       T02911                                 

Gene name
LIG4
Definition
(RefSeq) DNA ligase 4
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:fch00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    102050236 (LIG4)
Enzymes [BR:fch01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102050236 (LIG4)
DNA repair and recombination proteins [BR:fch03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     102050236 (LIG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 912 aa AA seqDB search
MASAPASQPSPKKTVASRVPFADLCSTLERIQQCKSRPEKTKYFKDFLDSWRKFHDALHQ
NEKDVTDSFYPAMRLILPHLERERMAYGIKETMLAKLYIELLNLPKDGKDAAKLLNYRAP
AGSRVDAGDFAMIAYFVLKPRSPKQGRLTIEQVNEHLDTIANNNAAKNKGLLKKSLLQLI
TQSTALEQKWLIRMIIKDLKLGVSQQTIFSIFHPDAAELHNVTTDLEKVCRQLHDPSVSL
SDVSITLFSAFKPMLAAIADVQQIEKQMNNQLFYIETKLDGERMQMHKDGDVYKYFSRNG
FDYTQQFGASPLDGSLTPFIHKIFKSNIQNCILDGEMMAYNPETQTFMQKGNRFDIKRMM
EDSDLQTCFCVFDVLMVNDEKLGHEVLSKRYEILSSVFTPVTGRIHVVHKKSARTRKEVI
DALNEAIDNREEGIMVKDPMSTYKPDKRGEGWLKIKPEYVNGLMDELDLLIVGGYWGTGA
RGGMMSHFLCAIAETPPPNEKPSIFHSICRVGSGYTMKELHDLGLKLAKHWKPYHRRDPP
CNILCGTEKPEMYIEPCNSVIVQIKAAEIVTSDMYKTECTLRFPRIEKIREDKEWYECMT
SDMLEDLRRKAEGKLASKHLHIDDYSKPQEKKRKTVSKVRKIIGIAEQFKAPDLSSVNKV
SSVFEDIEFCVMTGTGKYSKSELESRIAECGGSVVQNPGLDTYCVIVGTENVRVKNIIAS
NKYDVVRAEWILQCLQHKMLVPWQPAFMIHMSPDTKEDFAREYDCYGDSYTADTDVAQLK
EVFSRMKDNKMMLLEKIAELEERYSWNSCQLSIFRGNTIYVDFYAVVNEPRTKIHGTTLS
IRALELRFYGAKVVPHLEEGVSHIVIGEDHSRVEEMKALRRTFGKKFKIVSELWVIQSVE
EGVPKNENQYLI
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgcacctgcttcgcagccctctcctaaaaaaacggtggcttctcgagtgcct
tttgcggatttgtgttctactctagagcgaatacagcagtgtaaatctcgcccggagaaa
acaaaatatttcaaggatttcctggattcctggagaaaattccatgatgctcttcaccaa
aatgagaaagatgtcacagattctttttacccagcaatgcgacttattcttccacacttg
gaaagagaaaggatggcatacgggattaaagaaactatgcttgcgaagctgtatattgaa
ctgcttaatttaccaaaagacggaaaagatgctgcaaagcttttaaattacagagcacct
gctggctcacgtgtagatgctggagattttgcaatgattgcgtacttcgtattaaaacct
aggagcccaaaacaaggcagactgacaatagaacaagtcaatgaacacttagacacaata
gctaacaataatgctgctaaaaacaagggtctgttaaagaaaagtcttcttcagttaatt
acccagagcacagcactggaacaaaaatggctcatccggatgattataaaggatctaaag
cttggtgttagtcagcaaactatattttccatttttcatcctgatgctgctgaattacac
aatgtcacaactgatttggaaaaagtttgcagacaactgcatgatccctctgtctcactt
agtgatgtttctatcacgttgttttctgcctttaaaccaatgcttgctgcgattgctgat
gtccagcaaattgagaaacaaatgaataaccagctgttctacatagaaactaagctggat
ggtgaacgtatgcagatgcacaaagatggagatgtgtataaatatttttcccgaaatggg
tttgactatactcagcagtttggcgcctccccccttgatggttcattaacgccgtttatt
cataagatatttaagagcaatatacagaattgcattctcgatggtgaaatgatggcttac
aatcctgagacacaaacctttatgcaaaaagggaacaggtttgacataaaaagaatgatg
gaggactctgatctgcagacctgcttctgtgtgtttgatgtattgatggttaatgatgag
aagttggggcatgaagtactaagcaaaagatatgaaatcttaagtagcgtatttacccca
gtaacgggcaggatacatgttgtacataaaaaaagtgccagaacaagaaaagaagtaatt
gatgctttaaatgaagcaatagataacagagaggaagggattatggtgaaagatcccatg
tccacctacaagcctgacaaacgtggggaaggctggttaaaaatcaagccggaatatgtc
aatgggttgatggatgaactagaccttttaattgttggtggttactgggggacgggcgca
cgtggtggaatgatgtctcattttctgtgcgctattgcagaaacaccccctccaaatgaa
aaaccttccattttccactctatttgtcgtgttggctctggctatactatgaaggaattg
catgatctgggtttgaaactggctaaacactggaagccctaccataggagggatcctccc
tgtaacattttgtgtggaactgaaaaacctgaaatgtacattgaaccttgcaactctgtc
atagttcagatcaaggcagccgagattgttaccagtgatatgtacaaaactgagtgcact
ttgagattcccccggattgagaagataagagaggacaaagaatggtacgagtgcatgact
tcagacatgttagaagacctcagacgcaaagcagaagggaagctggcatctaagcacctt
catatagatgattatagtaagccacaagagaaaaaaaggaaaactgtatcaaaggtgagg
aagataattggaatagccgagcaatttaaagctcctgatctttctagtgtaaacaaggtt
tcaagtgtatttgaagatattgagttttgtgttatgacaggaacgggaaaatactcaaag
tctgaactggaaagcagaatagccgaatgtggtggcagtgtggtacagaacccagggctg
gatacttactgtgtcattgtaggaactgagaatgtcagagtgaaaaatatcattgcttcc
aacaaatacgatgtggtgagggcagagtggatccttcagtgtttacaacacaaaatgctg
gtgccttggcagccagcctttatgattcacatgtctcctgacacaaaagaagattttgct
cgcgagtatgattgttacggagacagctacacagcagacacagatgttgcacaactgaag
gaagtgttctcaagaatgaaagacaataagatgatgcttttggagaagattgcagagtta
gaagaacgttattcatggaacagctgtcagctcagtatattcagaggaaacactatttat
gtggacttttatgctgttgttaatgagcccagaacaaaaatccatggaacaacactatca
attagagctttggagctccgtttttatggtgcaaaagtagttcctcaccttgaagagggt
gtctcgcatattgttataggagaagatcattcccgggtagaagagatgaaagcactcagg
agaacatttgggaaaaaatttaaaattgtatctgagctgtgggtaatacagtcagtggag
gagggagttccaaagaatgaaaaccagtacttgatttaa

DBGET integrated database retrieval system