KEGG   Falco cherrug (Saker falcon): 102050356Help
Entry
102050356         CDS       T02911                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Arachidonic acid metabolism
Metabolic pathways
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102050356 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    102050356 (PTGS2)
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102050356 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 571 aa AA seqDB search
MTTGLDQYECDCTRTGYYGENCTTPEFFTWLRLTLKPLPNTVHYILTHFKGAWNIINDIP
FLRDAIMRYVLTSRSHLIDSPPTYNSDYSYKSWEAYSNLSYYTRSLPPVGLDCPTPMGVK
GKKELPDSKVIVEKFLLRKKFIPDPQGTNVMFTFFAQHFTHQFFKTDHKKGPGFTKALGH
GVDLNHIYGETLERQLKLRLLKDGKLKYQMIDGEMYPPTVKDTQAEMIYPPHVPEHLQFS
VGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWDDEQLFQTTRLILIGETIKIVIE
DYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQ
FLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGRNVPAAVQKVAKASIDQSRQMRYQSLNEY
RKHFMLKPFKSFEELTGEKEMAAELEELYGDIDAMELYPGLLVEKPRPGAIFGETMVEIG
APFSLKGLMGNAICSPEYWKPSTFGGKVGFEIINTASLQKLVCNNVKGCPFTAFHTLNPE
PTEATINVSTSKRAMEDINPTLLLKERSTEL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaggactggatcagtacgaatgtgactgcacgaggacaggatattatggggaa
aactgtacaacaccggaattcttcacgtggctgaggctaacattgaaacctttgccgaat
actgtccactacatcctcacccacttcaaaggagcctggaatatcatcaatgacattcca
ttcttaagagatgctattatgagatatgtattaacatcgagatcacacttgattgacagt
ccaccaacttacaatagtgattatagttacaaaagctgggaagcttattccaatctttcc
tattacacaagaagccttccaccagtaggacttgactgcccaacacccatgggtgttaaa
ggtaagaaagagcttccagattcgaaagtgattgtggagaagtttttgctgaggaaaaaa
tttattcctgacccacaaggcacaaatgtgatgttcacattctttgcccaacacttcact
catcagttctttaagactgaccacaagaaaggacctggcttcaccaaagctctcggccat
ggggttgacttgaatcatatttacggagagactctggagagacaacttaaactgagactt
ctaaaagatggaaagctaaaataccagatgattgatggagaaatgtatccaccaacagtg
aaggacactcaggcagagatgatctaccctcctcacgtacctgaacacttgcagttttct
gtcgggcaggaggtgtttggtttggtcccgggcttgatgatgtatgctacaatatggctg
agggaacacaaccgggtctgtgacatcctgaaacaggagcatccagagtgggatgatgag
cagctgttccaaactactagactcatactgataggagaaacaatcaagattgttattgag
gactatgtgcagcacttgagtggctaccacttcaaactcaagtttgatcctgaactgctg
ttcaaccagcgatttcaataccagaaccgaattgcagccgaattcaatactctctaccac
tggcacccgcttctgcctgacactttccagatacatgaccaggaatacactttccagcag
ttcctctacaacaactctataatgctggaacatggcctttcccatatggtgaagtctttc
tccaagcaaagtgctggcagggttgctggtgggagaaatgttcctgctgcagtacagaaa
gtagcaaaggcttcaattgaccaaagcagacaaatgagataccagagcttgaatgagtac
aggaaacacttcatgctgaaaccgttcaaatcatttgaagaacttacaggagaaaaagaa
atggcagctgaactggaagagctttatggagacattgatgctatggagctgtacccaggt
cttctcgtagaaaagccacgaccaggtgccatcttcggtgaaacaatggtggagatcgga
gcaccattctctctgaaaggactgatgggaaatgctatctgctcccctgagtactggaaa
cctagcaccttcggtgggaaagtgggcttcgaaataatcaatactgcctccttacagaag
ctcgtctgcaacaacgtgaaaggctgccctttcactgctttccacaccttaaatcctgaa
cccacagaggcaactattaatgttagtacctcaaaaagagcaatggaagatatcaacccc
acactactactgaaagagcgctctactgagttgtaa

DBGET integrated database retrieval system