Falco cherrug (Saker falcon): 102059204 Help Entry 102059204         CDS       T02911                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism fch  Falco cherrug (Saker falcon) Pathway fch03410   Base excision repair fch04140   Autophagy - animal fch04217   Necroptosis Brite KEGG Orthology (KO) [BR:fch00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     102059204 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102059204 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     102059204 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fch03036]     102059204 (HMGB1)    03400 DNA repair and recombination proteins [BR:fch03400]     102059204 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fch04147]     102059204 (HMGB1) Chromosome and associated proteins [BR:fch03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     102059204 (HMGB1) DNA repair and recombination proteins [BR:fch03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      102059204 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      102059204 (HMGB1) Exosome [BR:fch04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102059204 (HMGB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box RNA_pol_3_Rpc31 HMG_box_5 Motif Other DBs NCBI-GeneID:  102059204 NCBI-ProteinID:  XP_005446526 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSSKEKGKF EDMAKADKLRYEKEMKNYVPPKGETKKKFKDPNAPKRPPSAFFLFCSEFRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKVDAGKKVVAKAEK SKKKKEEEEDEDEDEEDEEDEEEEEEEDEDDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggcgatcctaaaaagccgagaggtaaaatgtcttcatacgccttctttgtg caaacctgccgggaggagcacaagaagaaacatccagatgcttcagtgaacttttcagag ttctcaaaaaaatgctcagaacgatggaagactatgtcttctaaggagaaagggaagttt gaagatatggcaaaggctgacaagcttcgttatgaaaaagaaatgaaaaactatgtacca cctaagggtgaaacaaaaaagaagttcaaggatccaaatgcaccgaagaggcctccttcg gcttttttcttgttttgctctgagtttcgtccaaaaatcaaaggagaacatcctggtctg tccattggggatgttgcaaagaaactgggagaaatgtggaacaacaccgctgcagatgat aaacagccttatgaaaaaaaggctgctaaactgaaggagaagtatgaaaaggatattgct gcataccgggccaaagggaaggttgatgcaggcaaaaaagtagttgccaaggccgagaag agcaagaagaagaaggaggaggaggaagatgaggatgaagatgaagaggatgaagaggat gaagaagaggaagaggaggaggatgaagatgatgatgatgatgaataa

DBGET integrated database retrieval system