KEGG   Fimbriimonas ginsengisoli: OP10G_1525Help
Entry
OP10G_1525        CDS       T03038                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fgi  Fimbriimonas ginsengisoli
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fgi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OP10G_1525
  Energy metabolism
   00680 Methane metabolism
    OP10G_1525
Enzymes [BR:fgi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     OP10G_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1640152..1642944
Genome map
AA seq 930 aa AA seqDB search
MRSFLNLEPEAFGLSAELSRDLRTLDRLLGKVLTEQEGDQMIDLARKLYSEKIDPATLFT
QIPELKDPNRLRGLARAFTLLFQLANTAEQKEIVRVNRERRGARRESIRDAVKELKHKGL
DAEAIQALIDRIEITPTLTAHPTEAKRKVVLDKLQSIALLLAEDDSGPLLTSPLDVANRA
TEEIERTLTELWQTDEMRATRLSVGEEVRNALYFFERTIMEVVPWLHGDLARALAEEFPG
HEFRIPTFLTYRSWVGGDRDGNPNVTPELTWQTLLDHRIQALETYLPRVEALRRELTQSV
KLVGVSPELTASLEADLKRLPYKPEAVQRYSQEPYVLKLLGVEERLRETLAQARALAGGR
RGQFENLFASPDELLADLNLIQTSLRANRAAEIADEGRLPHLIRQVEAFGFHLATLDLRQ
HSDEHAKALDEILVAAGVLPAGTNYRDLPEAEKIELLKAELRSPRPLLPVGYTGSETCRR
VLDVFHVTRRARAELSDRSIVAYVISMTHGVSDMLEVLLFCKEAGLFRLLPDGTVESELE
VVPLFETIEDLHGSADLMRQLFSNESYRLHLEARGGRQEIMLGYSDSSKDGGYLAANWAL
QWTLAEIAKVSEELHIPIRLFHGRGGTVGRGGGRANKAILSQPAGSFSGRIRFTEQGEVI
SFRYSLPPIAHRHLEQIVSAVLLAAAGGGNADAERQYGEVMAELEETSRAAYRSLVYDDP
DFWAFYTQATPIEHISLLPIASRPVFRPGKALSGIEGLRAIPWNFAWVQSRTTLVGWYGM
GTALEKYVNSSPANLETVRTMYRGWPFFRTVVDNAQLELVRAHIPTARLYAARVEPKELG
DRMERTIEEEHARTEQMILRITGQERLLESARVVRSTVEFRNPAVMPLSVVQVALMDAWE
SLSEEEQAGAWREAMLQSIAGIAAAMQSTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcgttcttgaacctggagccggaggcgtttgggctttcggcggagttgtcgcgg
gatctgcgaacgctcgaccggctgctggggaaggtcctgaccgagcaggaaggggatcag
atgatcgacctcgcccggaagctctattccgagaaaatcgatcccgccaccctcttcacc
cagattcccgagctgaaagacccgaaccgccttcgcggcctcgcccgagccttcaccctt
ctcttccagctcgccaacactgccgaacaaaaggaaatcgtccgggtcaaccgggagcgg
cgcggcgcgcgtcgggagtcgatccgcgacgcggtgaaggagctgaagcacaaaggcttg
gatgccgaagccattcaggctctgatcgatcgaatcgagatcacgccgaccctcaccgcc
catcccaccgaagcgaagagaaaggtcgtcctcgacaaactccagagcatcgcccttctc
ctcgcggaagacgattccggccccctcctcacctccccgctcgatgtcgcgaaccgggcg
accgaagagatcgagcggaccctcaccgaactgtggcaaaccgacgagatgcgggcgacc
cgcctcagcgtgggcgaagaggtccgcaacgcgctttacttcttcgagcggaccatcatg
gaggtcgtcccctggcttcacggcgacctcgcccgggcgctagccgaggagtttccgggc
cacgagttccggattcccaccttcctcacctaccgctcctgggtcggcggcgaccgcgac
ggtaacccaaacgtcaccccggagctaacctggcaaacgctgctggatcaccggatccaa
gcgctggaaacgtacctcccgcgggtcgaggcactccgtcgcgaactcacccaaagcgta
aagctggtcggcgtctcgccggagctgacggcttccctggaagccgacctcaagcgcctc
ccctataagccggaagcggtccagcgctactcgcaagagccatacgtcctcaagctcctg
ggcgtagaggagcggctccgggagacgctggcccaagcgcgcgccctcgccggcggccgc
cgggggcagttcgagaacctcttcgcctcgcctgacgagctgctcgccgatctcaacctg
atccaaaccagcctgagagccaaccgggccgcggagatcgccgacgagggaaggctcccc
catctcattaggcaggtggaggcgttcggattccatctggccacgctcgatcttcggcaa
cacagcgacgagcacgctaaagcgctcgacgagatcctcgtcgcggccggagtgctgccc
gctggaacgaactaccgggatctcccggaggccgaaaagatcgagctcctcaaggccgag
ctccgcagcccgcgccccctgctgccggtcggttacaccggctccgagacctgccggcga
gtgctcgacgtgttccacgtaacacgccgggcgagggcggagctaagcgaccgctccatc
gtcgcctacgtcatctcgatgacccacggagtgagcgacatgctggaggtgctcctcttc
tgcaaggaggccgggctcttccgccttctccccgatggaaccgtcgaaagcgagctcgag
gtcgtcccgctgttcgagaccatcgaagaccttcacggctccgccgacctgatgaggcag
cttttctccaacgagagctaccggctccacctggaggcgagaggcgggcggcaagagatc
atgctcggttacagcgacagcagcaaggacggcggctatctcgccgcgaactgggcgctg
cagtggacgctggccgagatcgcgaaggtgagcgaggagcttcatattccgattcggctc
ttccacggccgaggcggcaccgtcggacgcggtggcggacgcgccaacaaggcgattctc
tctcaacccgccggttcgttcagcggccggatccggttcaccgaacagggcgaggttatc
agtttccgctactcgctcccgccgatcgcccaccgccacttggagcagatcgtaagcgcg
gtcctcctggccgccgccggcggtgggaatgcagacgccgagcgccagtacggcgaggtg
atggccgaactcgaggagacctcccgcgccgcttaccggtcgctggtgtacgacgatccc
gatttctgggcgttttacacccaggccacccccatcgagcacatctcgctgcttcccatc
gcatctcgtcctgtctttcgtcccggaaaggcgctctccggaatcgaaggtttgcgagcc
atcccgtggaacttcgcctgggtgcaaagccggaccaccttggtcggctggtacggcatg
gggaccgcgctcgagaagtatgtcaattcctcacccgccaacctcgagaccgtgcgcacg
atgtaccgcgggtggccgttcttccgcaccgtggtcgataacgcccagctcgagctggtc
cgcgcgcacatccctaccgctcgcctgtacgccgcccgcgtcgagccgaaggaactcggc
gaccggatggagaggacaatcgaagaggagcacgcccgcaccgagcagatgatcttgcga
atcaccggtcaagagcggctgttggaatccgcccgggtcgtgcggagcaccgtggagttc
cgcaacccggcggttatgccgctcagcgtcgtccaagtagcgctcatggatgcgtgggaa
agccttagcgaagaagagcaggccggcgcctggcgggaagcgatgcttcagagcatcgcc
ggcattgcggcggcgatgcagagcacgggataa

DBGET integrated database retrieval system