KEGG   Filomicrobium sp. W: BN1229_v1_0430Help
Entry
BN1229_v1_0430    CDS       T03856                                 

Gene name
tufB
Definition
(GenBank) protein chain elongation factor EF-Tu, possible GTP-binding factor (duplicate of tufA)
  KO
K02358  
elongation factor Tu
Organism
fil  Filomicrobium sp. W
Brite
Translation factors [BR:fil03012]
 Eukaryotic Type
  Elongation factors
   BN1229_v1_0430 (tufB)
 Prokaryotic Type
   BN1229_v1_0430 (tufB)
Mitochondrial biogenesis [BR:fil03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BN1229_v1_0430 (tufB)
Exosome [BR:fil04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BN1229_v1_0430 (tufB)
  Exosomal proteins of breast cancer cells
   BN1229_v1_0430 (tufB)
  Exosomal proteins of colorectal cancer cells
   BN1229_v1_0430 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:421253..422443
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTSLTAAITKVLAETGGATFSAYDQIDRAPEEKARG
ITISTSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDEELLELVEMEVRELLSSYEFPGDDIPITKGSALVALE
DGDAKLGHDAILALMQTVDEYIPTPDRPKDQPFLMPIEDVFSISGRGTVVTGRIERGIVK
VGEEVEIVGIRDTTKTTVTGVEMFRKLLDQGEAGDNVGALLRGIGREDVERGQVLCKPGS
IKPHKKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNVS
MDVELITPIAMEEKLRFAIREGGRTVGAGVVAAIVE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcgaaattcgagcggacgaagccgcacgtaaacatcggcacgatcggtcac
gttgaccacggaaagacgtctctgacggcagcgatcacgaaggtattggctgagacgggt
ggggcaacgttttcagcttacgaccagattgaccgtgcaccggaagagaaggctcggggc
atcacgatttcgacgtcgcacgttgagtatgagacggcgaaccgtcactacgcgcacgtt
gattgcccaggtcacgcggactacgtgaagaacatgatcacgggtgcggcgcagatggac
ggcgcgattctggtcgtttcggctgctgacggcccgatgccacagacgcgcgagcacatc
cttctggcccgtcaggtcggcgttcctgcccttgtcgtgttcctgaacaagtgcgacatg
gtcgacgatgaagagcttcttgagctcgttgagatggaagtgcgcgagcttctgtcgtct
tacgagttccctggcgacgacatcccgatcacgaagggctcggctctggttgctctggaa
gacggtgatgcgaagctcggccacgacgcgatcctggctctgatgcagacggttgatgaa
tacatcccgacgccggaccgtccgaaggatcagccgttcctgatgccgatcgaagacgta
ttctcgatttctggccgcggtacggttgttacgggccgtattgagcgtggcattgttaag
gtcggtgaggaagtcgagatcgtcggcatccgtgatacgacgaagacgactgtcacgggc
gttgaaatgttccggaagcttctggatcagggcgaggctggcgacaacgttggcgctctt
cttcgtggtatcggtcgtgaggacgttgagcgcgggcaggttctttgcaagccgggctcg
atcaagccacacaagaagttcaaggctgaggcatacatcctgacgaaggaagaaggcggc
cgtcacacgccgttcttcacgaactatcgtcctcagttttacttccgtacgacggacgtg
acgggtgtcgtcacgcttccagaaggcacggaaatggttatgcctggcgacaacgtgtcg
atggacgttgagctgatcactccgatcgcgatggaagagaagcttcgcttcgcgatccgt
gaaggcggccgtacggtcggcgcgggtgttgttgccgcgatcgtcgaataa

DBGET integrated database retrieval system