KEGG   Fischerella sp. NIES-3754: FIS3754_41300Help
Entry
FIS3754_41300     CDS       T04195                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
fis  Fischerella sp. NIES-3754
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:fis00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    FIS3754_41300
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    FIS3754_41300
Enzymes [BR:fis01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     FIS3754_41300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4758600..4760030
Genome map
AA seq 476 aa AA seqDB search
MSYAQTKTQTKAGYQAGVKDYRLTYYTPDYTPKDTDILAAFRVTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQYICYVAYPLDLFEEGSVTNMLTS
IVGNVFGFKALRALRLEDLRIPVAYLKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFVAEAIHKAQAETGEIKGHY
LNVTAPTCEEMLKRAEFAKELKMPIIMHDYLTAGFTANTTLAKWCRDNGLLLHIHRAMHA
VIDRQKNHGIHFRVLAKCLRMSGGDHIHTGTVVGKLEGERGITMGFVDLLRENYVEQDKS
RGIYFTQDWASMPGVMAVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEACIQARNEGRNLAREGNDVIREAAKWSPELAAACELWKEIKFEFEAVDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgctcaaacgaagactcagactaaagcagggtatcaagctggggtaaaagat
tacagactaacttattacacccctgattacacaccaaaagacacggatatcttagcagca
ttccgtgttacaccccagccaggggttccacccgaagaagctggcgctgctgtggcggct
gagtcttccactggtacttggacaaccgtgtggacggacttgctgaccgacctagaccgc
tacaaaggtcgttgctatgatatcgaaccagttccaggcgaagacaatcagtatatttgt
tacgtagcctatcccctggatctgtttgaagaaggttctgtaaccaatatgttgacctca
attgtaggtaacgtatttggtttcaaagctctacgggcactgcgtctggaagacctgcgg
attccagttgcttacctcaagactttccaagggcctccccacggtatccaagttgagcgt
gacaaattaaacaaatacggtcgtcctttgttgggttgcaccattaagcccaaactcggt
ttgtctgcgaagaactacggacgcgctgtatacgagtgcttgcgcggtggtttggacttc
accaaagacgacgaaaatattaactcccagccctttatgcggtggcgcgatcgcttcttg
ttcgttgcagaagcaattcacaaagcccaagcagaaacaggtgaaatcaaaggtcactac
ctaaacgttactgctcccacctgcgaagaaatgctgaagcgggctgagttcgcaaaagaa
ctcaagatgcccatcatcatgcacgactacttaaccgcaggtttcaccgccaacactact
ttggctaagtggtgtcgtgacaacggtctattgctccacattcaccgggcgatgcacgct
gtaattgaccgtcaaaagaatcacggtatccacttccgtgttttagctaagtgcttgcgg
atgtctggtggtgatcatattcacactggtacggtggtcggtaagctggagggtgagcgc
ggtattaccatgggctttgttgacctgctgcgcgaaaactatgttgagcaagacaagtct
cgtggtatatacttcacccaagattgggcttctatgcctggtgtcatggcagttgcttct
ggtggtattcacgtatggcacatgccagcattggtggaaatctttggtgatgactcggta
ctgcaattcggtggtggtactcttggtcacccctggggtaacgctcctggtgcaaccgct
aaccgtgtggctttggaagcttgtattcaagctcgtaacgaaggtcgcaacttggctcgc
gaaggtaacgacgttatccgtgaagctgctaagtggtctcctgagttggctgctgcttgt
gaactgtggaaggaaatcaagttcgagttcgaggcagttgatacagtctga

DBGET integrated database retrieval system