KEGG   Flavobacterium johnsoniae GSE09: BB050_01373Help
Entry
BB050_01373       CDS       T04718                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fjg  Flavobacterium johnsoniae GSE09
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fjg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BB050_01373 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    BB050_01373 (sucA)
   00380 Tryptophan metabolism
    BB050_01373 (sucA)
Enzymes [BR:fjg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BB050_01373 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1590783..1593560
Genome map
AA seq 925 aa AA seqDB search
MDRFSFLNAAHTEFFAQLYDQYLVNPDSVEPSWRSFFQGFDFGQTTYNDENPVQTIVEYV
TSDNTDYSQISEKLKKEFNVLKLIDGYRTRGHLFTKTNPVRDRRTSSPTLDIENFGLSTA
DLSTVFDAAQTIGMAPSSLQDIVNRLKTIYCQHIGIEYMYIRNPNVVKWIQDKLAVNTNQ
PNFSTEEKKIILNKLNEAVSFENFLHTKYVGQKRFSLEGGESIIPALDALIEQAAEKGVE
QFVMGMAHRGRLNVLANIFGKSTQDIFGEFDGKDYDQEYFDGDVKYHLGLTADRKTRSGK
SININLAPNPSHLETVGAVIEGITRAKQERHFPENISKVLPIAVHGDAAIAGQGILYEII
QMSLLDGYKTGGTIHIVINNQVGFTTNYLDARSSTYCTDVAKVTLSPVLHVNADDAEAVV
HAVSFALDYRMQFGRDVFIDLLGYRKYGHNEGDEPRFTQPVLYKIIAKHKNPRDIYAEKL
LSDGVIDASYVNALEKQYKSQLEENLEASRKKDLTIITPFMKNEWEGFVQVTDTQMLQKV
DTSYPKEKLTQIANALSNLPEDKKFISKIQKLINDRKTMFFETNLLDWGMAEHLAYGSLL
QEGFDVRISGQDVERGTFSHRHAVVKVEDSEEEVILINSLEDKKGNFNVYNSHLSEYGVL
GFDYGYALASPKALTIWEAQFGDFSNGAQIMIDQYISCGEDKWNNQNGIVLLLPHGYEGQ
GAEHSSARMERYLQLCARHNMYVADCTTPANFFHLLRRQLKTNFRKPLVVFTPKSLLRDP
RCVSPVEDLANGSFQETIDDTTVNKKDVKTLVFVTGKFYYDITAERENNGRKDVAVVRIE
QLFPFPVEQLKEIIAQYPNADDYVWAQEEPKNMGAYSYMLMNFDLVKWRLASLKAYSAPA
SGSYTRAKRRHADAIRMVFDKNLFR
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggataggttttcatttttaaacgcagcgcatactgagttttttgcacaattatacgat
caatatttagttaacccagacagcgttgagcctagctggagaagtttctttcaaggtttt
gactttgggcaaacgacttataatgacgaaaatccagtgcaaacgatcgttgagtacgtg
actagcgataacacagattacagtcagatttctgaaaaactaaagaaagaatttaacgtt
cttaaattaattgacggataccgtacgcgcgggcatttattcacgaaaacaaatcctgtt
cgtgatcgtagaacttcatctccaactttggatattgaaaacttcggattatctacagca
gatctttcaactgtttttgacgctgctcaaacaatcggaatggcgccttcttcattgcaa
gatatcgtaaatcgtctaaaaactatttactgccagcatatcggtattgagtatatgtac
attagaaatcctaatgttgtaaaatggattcaggacaaattagctgtaaatacaaatcag
cctaatttctctacagaggaaaagaaaataatcttaaataaattaaacgaagccgtttct
tttgagaacttccttcacactaaatatgttggacaaaaacgtttctcattagaaggtgga
gaatctatcatcccagctcttgacgctttaattgagcaagctgcagaaaaaggtgttgaa
caattcgtaatgggaatggctcaccgtggtcgtttgaacgttttggcaaatatcttcgga
aaatctactcaagatatttttggtgagtttgatggaaaagactacgatcaagagtatttt
gacggtgacgtaaaataccacttaggtcttacggcagacagaaaaacaagatctggaaaa
agcatcaatatcaatttagcgccaaacccttctcacttagaaactgttggagcggtaatt
gaaggtatcacaagagcaaaacaagaaagacatttcccagaaaatatttcaaaagtattg
ccaattgctgttcacggtgatgcggctatcgctggtcagggcattttgtatgaaatcatt
caaatgtctttattggacggatacaaaactggcggtacaattcatatcgtaatcaacaac
caagttggttttacaacaaactatttagatgctcgctcatctacttactgtacagacgtt
gccaaagtaacgctttctccagtattacacgtaaatgctgacgatgcagaagctgttgtt
cacgcggtatcttttgcattagattacagaatgcagtttggacgtgacgtatttatcgat
ttattaggatatagaaaatacggacataacgaaggtgatgagccacgttttactcagcct
gttttatacaaaatcattgctaaacataaaaatccaagagacatctacgcagaaaaatta
ctttctgacggtgtaatcgatgcttcttatgtaaatgctttagaaaaacaatacaaatct
caattggaggagaatttagaagcttctcgtaaaaaagatttgactatcattactccattc
atgaaaaatgaatgggaaggttttgttcaggttacagacacgcaaatgcttcaaaaagtt
gatacttcttatccaaaagaaaaattaactcaaattgcaaatgcactttctaatttgcct
gaagacaaaaaattcatcagtaaaattcaaaaattaatcaacgacagaaaaacaatgttc
ttcgaaactaatcttttagattggggtatggctgagcatttagcatacggatctttattg
caagaaggttttgatgttcgtatttctggacaagacgtagaaaggggaactttctctcac
cgtcacgctgtagttaaagttgaagattctgaagaagaagtaatcttaatcaacagctta
gaggacaaaaaaggaaactttaatgtttacaactctcacttatctgagtacggagtttta
ggttttgattacggatatgcattggcaagtccaaaagctttgacaatctgggaagcacaa
tttggagatttctctaacggagctcaaattatgattgaccaatacatttcttgtggtgaa
gataaatggaacaaccaaaatggtattgttcttttattgcctcacggatacgaaggacaa
ggtgctgagcactcttctgcaagaatggagcgttatttacagctttgtgcaagacataat
atgtatgttgcagattgtacaacgcctgctaacttcttccacttattaagaagacaatta
aaaacaaatttccgtaaaccgcttgtagtatttactccaaaaagtttactacgtgatcca
agatgcgtatctccagtagaagatttagcaaatggaagtttccaagaaactattgacgat
actacagttaacaaaaaagatgttaaaacattagttttcgttacgggtaaattctactat
gatattactgcagaaagagaaaacaacggaagaaaagacgttgctgttgttcgtatcgag
caattatttcctttccctgttgagcagctcaaggaaatcatcgcacaatatccaaatgca
gatgactatgtttgggctcaggaagaacctaaaaacatgggagcttacagctatatgtta
atgaactttgatctagtaaaatggagattggcttcattaaaagcatattctgctccagca
tcaggaagttatacacgtgctaaacgccgtcatgctgatgcaattagaatggtattcgat
aaaaatttatttagataa

DBGET integrated database retrieval system