KEGG   Fomitiporia mediterranea: FOMMEDRAFT_104821Help
Entry
FOMMEDRAFT_104821 CDS       T03132                                 

Definition
(RefSeq) glutathione S-transferase P subunit
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
fme  Fomitiporia mediterranea
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:fme00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FOMMEDRAFT_104821
Enzymes [BR:fme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     FOMMEDRAFT_104821
Transporters [BR:fme02000]
 Other Transporters
  Pores ion channels [TC:1]
   FOMMEDRAFT_104821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 262 aa AA seqDB search
MSKESAKKKARTDEKYQLYYWPGIPGRGEPIRLAFEEAGASYEDVTYTQGVSALTNLIKN
GTHFAPPVLRHGDLEISQLPNIMLYLGQKLKLVPDSDEAKYKVNQYFLTIMDLQNEAHDV
HHPISVALYYEDQKDAAKERAKDFREARIPKFFKHFETVLSKNKEGKGEWLYGTDLTYAD
LALYHLVEGLLFAFPRAVGDILNDYPKIFDLHHRVKARPRIAAYLESDRRPKFSNGLYRH
YEELDSPEKDVPGKGGKEQEAD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaatctgcaaagaaaaaggccaggacggacgaaaagtaccaactatactat
tggcctggtatcccaggccgcggtgagccgattcggctcgcatttgaggaggctggtgca
tcttatgaggatgtgacctatactcagggtgtcagcgcactgacgaatttgatcaaaaat
ggaactcactttgccccaccggtccttcgccatggtgacttggagatttctcagttgcca
aatatcatgctctatcttggtcagaagcttaagctggtcccagactcagatgaggccaaa
tataaagtcaaccaatactttttgacaatcatggatctccaaaatgaagcgcatgatgtc
catcaccccatttccgttgctctttactacgaggaccagaaggatgctgccaaggagcgt
gccaaagacttccgcgaagcacgtatcccaaagttctttaagcatttcgagacggttctc
tcaaaaaacaaggagggcaaaggagaatggctatatggcacagaccttacatatgcagat
cttgcactgtaccatctcgttgaagggttgctatttgcctttcctcgtgctgtcggagat
attctgaacgattatccgaaaatctttgaccttcatcatcgagtcaaggctcgtccccgt
atcgcagcttatctcgagagtgatcgtcgtccgaagttctccaatggtctgtatcgccat
tatgaggagcttgattcacccgagaaggatgttccagggaagggaggaaaagaacaggaa
gcagactga

DBGET integrated database retrieval system