KEGG   Fomitiporia mediterranea: FOMMEDRAFT_21699Help
Entry
FOMMEDRAFT_21699  CDS       T03132                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00010  Glycolysis / Gluconeogenesis
fme00051  Fructose and mannose metabolism
fme00052  Galactose metabolism
fme00500  Starch and sucrose metabolism
fme00520  Amino sugar and nucleotide sugar metabolism
fme01100  Metabolic pathways
fme01110  Biosynthesis of secondary metabolites
fme01130  Biosynthesis of antibiotics
fme01200  Carbon metabolism
Module
fme_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fme_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FOMMEDRAFT_21699
   00051 Fructose and mannose metabolism
    FOMMEDRAFT_21699
   00052 Galactose metabolism
    FOMMEDRAFT_21699
   00500 Starch and sucrose metabolism
    FOMMEDRAFT_21699
   00520 Amino sugar and nucleotide sugar metabolism
    FOMMEDRAFT_21699
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FOMMEDRAFT_21699
Enzymes [BR:fme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     FOMMEDRAFT_21699
Membrane trafficking [BR:fme04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    FOMMEDRAFT_21699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 UPF0270
Motif
Other DBs
NCBI-GeneID: 18678075
NCBI-ProteinID: XP_007268558
JGI: Fomme1_21699
LinkDB All DBs
Position
Unknown
AA seq 497 aa AA seqDB search
MSTVSNISSIFFYNVPDATRSHLDSIQRQFDLTDARLLEITRQFVDDFALGLSEYNKPMA
MIPTFVTGVPDGTEKGTFLALDLGGTNLRVCEVQLHGNQQFTLRQQKYKLSEVLKTGEAT
VLFDYLADSVDEFLTSMGHEITDDEALHLGLTFSFPVEQTALDKGVLLTWTKGFSAKNAV
GKDVVKLLQDAFDRKHIHVKCAALVNDTVGALLSRAYTSGGCILGAIFGTGTNGAFVEDV
QKIRKLSDSAALKHVQTMVVNTEWGAFNNTRTVLPTTPFDNKLDRESINPRYQAYEKFIS
GMYLGEICRNILLSLVDAVPPVLFGGLSTPILNSQYGFDTAYMSDIENAQALDDIKKVLV
EKVDFEAGAISDQDAEIVRWVCRLVATRAAKLSGCAVAAVLVQTGRAALGGGHSSGEKFA
VGVDGSLIQFYPNFETHLRESLRAIVGEEAERKVEIGLAKDGSGVGAALCALQALKQSQG
DTVVSANKSVPNGPGKA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagtgtctaatatttcttccatcttcttctacaacgttcccgacgccacgcga
tcccacctcgatagcatacagaggcaattcgatctgactgatgcacgcctcctcgagatc
actcgacagttcgtcgatgactttgctttgggactctcagaatacaataaaccaatggcc
atgataccgacgttcgttactggtgtccccgacggcacagaaaaggggacgttccttgct
ttggatcttggcgggacaaatttacgtgtctgcgaggtccagctgcatggtaatcagcag
tttactcttcgacaacagaaatacaaactgtcagaggttttgaaaactggcgaggctact
gtgctatttgattacctcgcggactccgttgatgagttcctgacgtctatgggccacgag
attaccgatgatgaggcattacaccttggcctcacttttagcttcccggtcgaacagacg
gcactggacaaaggtgtgcttttgacgtggacgaaagggttttctgcaaagaatgctgtt
ggcaaggacgttgtgaaactgcttcaagacgcttttgataggaagcatatccatgtcaaa
tgcgccgccctagtcaacgacaccgttggcgcccttttatcacgagcatatacgtctgga
ggttgcatacttggcgccatttttggaaccgggacaaacggagccttcgttgaagatgta
caaaaaattcggaagctatcagactctgcagcattaaaacatgtgcagacaatggtcgtg
aatactgaatggggcgcgttcaataatacacgtaccgtccttcccactacgccattcgac
aataagctcgacagagaatcaatcaacccaaggtatcaggcatacgaaaaattcatcagt
ggaatgtaccttggcgaaatttgtcgtaatattctattatctctcgttgatgctgttcca
cctgtactctttggcggcctctcaaccccaattctcaacagccagtatggttttgatacc
gcatacatgtcggatattgaaaatgcacaggcattggacgatattaagaaggtccttgtc
gagaaagttgacttcgaggccggcgccatctcggaccaagatgctgagattgtacgctgg
gtatgccggctcgtggctacaagggcagcgaagctcagtggatgtgcggtcgcagctgta
ttagtacaaacaggacgtgctgctctcggcggaggacactcttcgggcgagaagtttgcc
gttggcgtagatggaagccttatacaattctatcccaacttcgagacacaccttcgggaa
agtctgcgtgcgattgtcggcgaagaggctgagagaaaggtggagatcggattggcgaag
gatgggagtggtgtgggagccgcgctttgtgcgcttcaagctcttaagcaatcccagggt
gatacggttgtaagcgcgaataaatctgttcctaatggaccagggaaagcataa

DBGET integrated database retrieval system