KEGG   Formosa sp. Hel1_33_131: FORMB_23620Help
Entry
FORMB_23620       CDS       T04465                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
for  Formosa sp. Hel1_33_131
Brite
Enzymes [BR:for01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     FORMB_23620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Trep_dent_lipo Big_3_5
Motif
Other DBs
NCBI-ProteinID: AOR29380
UniProt: A0A1D7Y1R7
LinkDB All DBs
Position
complement(2431012..2431596)
Genome map
AA seq 194 aa AA seqDB search
MKNSILALLLIFSVLSCKQEVKKTNTSDKDMLNTEQKQEPVQKMRSLTIALSPKSNSTVT
GTAKFVETNGMVQMTAVIKGLSEGSHAIHIHKTGDCTSTDGKSAGGHWNPTAQPHGKWGA
ETGYHKGDIGNFMVKNAADDTTVEFSTDEWCIGCGDDTKDILGKGVIVHQGMDDFTSQPS
GAAGSRVSCGGIIE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcgattctagctttacttcttattttcagtgtattatcctgtaaacaagaa
gtcaaaaaaacaaatacgtctgacaaagacatgcttaataccgagcaaaaacaagaaccc
gttcaaaagatgcgctctttaacaatcgctctcagcccaaaaagtaacagtacagtgact
ggaacggctaaatttgtagaaaccaacggcatggttcagatgactgcggtcatcaaagga
ctttccgaaggatctcatgcgatacatattcataaaacaggtgattgtacatctacagat
gggaaatcggctggagggcattggaatccaacggcgcaaccacatggaaaatggggtgct
gaaacgggctaccacaaaggagatattgggaattttatggttaaaaacgcagcggatgat
acaaccgttgagtttagtacagatgaatggtgtattggctgtggagatgacacaaaagat
atcctaggcaaaggcgttattgtgcaccaaggtatggacgattttacatctcaaccctca
ggagctgctggcagccgtgtgagttgtggaggaattatcgaataa

DBGET integrated database retrieval system