KEGG   Falco peregrinus (peregrine falcon): 101916059Help
Entry
101916059         CDS       T02856                                 

Gene name
NSD2, WHSC1
Definition
(RefSeq) nuclear receptor binding SET domain protein 2
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101916059 (NSD2)
Enzymes [BR:fpg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101916059 (NSD2)
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101916059 (NSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD HMG_box zf-HC5HC2H HMG_box_2 zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 101916059
NCBI-ProteinID: XP_005229892
LinkDB All DBs
Position
Un
AA seq 1368 aa AA seqDB search
MDFSIKRSSQLLTRKINYIKMKQVPEILGNTNGKTQNCEVNRECSVYLGKAQLSATLQEG
VMQKYNGHEALPFIPADKLKDLTSRVFNGESGAQDAKLRFEPQEIKGVATPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDNGADVSQSEENEQKPANKERRNRKRSIKYDSLLE
QGLVEAALVSKTSSPTEKKAPAKRDPTQSIIKEDKVHLLKYNIGDLVWSKVSGFPWWPCM
VSADPVLHSYTKLKGQKKSFRQYHVQFFGDAPERAWIFEKSLVPFKEKDQFEQLCQESAK
QALTKAEKIKMLKPVSGKLRPQWEMGVKQASEAVGMTVEERKAKYTFIYVRDRPHLNPRV
AKEVGIAVEPLEEIDESSYSNEETTQNLKSMKESGIPNKRRRRTSKLSATDDTQESNQPG
TKNTTPQKSSEQAESKRGIGSPLNRKKTPGSTPRSRKGDAVSQFLVFCQKHRDEVVAEHP
DASSEEIEELLESQWNMLSEKQKARYNTKFAIVTSPKSEEDSGNLHGNKRNQKKRTKEPT
EDFEVQEAPRKRLRMDKQNNRKRETSNDKTAKTNSSKVTETSSSQKNQSATKNLSDACKP
LKKRNRASAAESSTLAFSKSSSPSASLTENEISDGQGDERSESPYESADETQTEVSISSK
KSERGAGTKKEYVCQLCEKTGDLLLCEGLCYRAFHVSCLGLSGRPAGKFICSECTSGVHT
CFVCKERKADVKRCVVSHCGKFYHEACVKKFHLTVFENRGFRCPLHSCLSCHVSNPLHPR
ISKGKMMRCVRCPVAYHAGDVCIAAGCAVIASNSIVCTNHFTAMKGKSHHAHVNVSWCFV
CSKGGSLLCCESCPAAFHPDCLNIEMPDGSWYCNDCRAGKKLHFQDIIWVKLGNYRWWPA
EVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYHGIKGIGK
VFKNALQEAEARFREIKLQREAKETQESERKPPPYKHIKVNKPCGKVQIYTADISEIPKC
NCKPTDENPCGFDSECLNRMLMYECHPQVCPAGERCQNQCFTKRQYPETKIIKTDGKGWG
LVAKRDIKKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNY
SRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCKCGAP
NCSGFLGDRPKNSSTNASEEKGKKTKKRTRRRRTKNEGKKQSEDDCFRCGDGGQLVLCDR
KSCTKAYHLSCLGLVKRPFGKWECPWHHCDVCGKPSVSFCHFCPNSFCKEHQDGTVLNSM
LNGQLCCSEHVLGVDSVETQKSEKPRKKLNKLKPKRKQRNRWMRAECK
NT seq 4107 nt NT seq  +upstreamnt  +downstreamnt
atggactttagcatcaaaagaagttctcaactgttaactcgaaaaattaactacatcaaa
atgaagcaggtaccagagatccttggaaataccaatgggaaaactcagaattgtgaagtg
aatcgtgagtgttctgtctacttgggcaaagcacaactttctgccaccctccaagaaggt
gtcatgcaaaaatataatggccatgaggctcttccgtttattccagctgataaattgaaa
gatctaacctctcgtgtgtttaatggcgagtctggggcccaagatgccaagctgcgcttt
gaaccccaggaaatcaagggagttgcaacaccacccaacactactcctatcaagaatggc
tctccagaaattaagctgaaaatcactaaaacatacatgaatggaaagcctctttttgaa
tcttccatttgtggagacaatggtgcagatgtgtctcagtcagaggaaaatgaacaaaag
ccagcaaacaaggagaggagaaacaggaaaagaagcataaaatatgactccttacttgag
cagggtcttgttgaagcagcactagtatcaaagacttcaagccctactgaaaagaaggct
cctgctaagagggatccaactcaaagtatcatcaaagaagacaaagtccatctgttgaag
tataatataggagatctagtgtggtcaaaagtgtctggtttcccatggtggccatgtatg
gtttctgctgatcctgttcttcattcctacactaaactaaaaggacagaaaaagagtttt
cgtcaatatcatgttcagttttttggagatgccccagagcgagcctggatatttgagaag
agccttgtgcccttcaaagaaaaagaccagtttgaacagttatgccaggaaagtgcaaaa
caagccctcactaaagcagagaaaataaagatgttaaagcctgtttcagggaagctgcgg
ccacagtgggagatgggtgttaaacaagcaagtgaagcagtaggcatgacagtggaagaa
cggaaggccaagtacaccttcatctatgttagggacagacctcatcttaatcctcgagtg
gcaaaggaagttggcattgctgtggaaccgttggaggagatagatgagtcatcttactca
aatgaagaaaccactcaaaatctgaaatcaatgaaggagtctggcattcctaacaagagg
aggagaaggacatcaaaattgtctgccactgatgatacgcaagaaagcaatcagccaggg
actaagaatactactcctcaaaagtcatctgaacaggcagaatccaaaagagggataggc
tcccctctcaatagaaagaaaactccaggatctactccacgaagccgaaagggcgatgca
gtatctcagtttttggtcttttgtcagaagcacagagatgaggtggttgctgaacatcca
gatgcttcaagtgaggagattgaagaattgctggaatcgcagtggaacatgcttagtgaa
aaacagaaagctcgctataacacaaagtttgccatagtgacctctcccaaatctgaagaa
gactctggtaacttacatggaaataaaagaaaccaaaaaaagaggacaaaggaacctaca
gaagattttgaagttcaggaagcacctaggaaaagactcaggatggataaacagaataat
cggaagagggagacaagcaatgacaaaacagcaaaaacaaactcttctaaggtcacagaa
acctcctcttcacaaaagaaccagtcagcaacgaaaaatctgtctgatgcttgtaaacct
ctgaagaagcgaaatcgggcttcagcagcagaatcttcaactcttgcttttagcaagagt
tcatctccttcagcttccttaactgagaatgagatctccgatggccaaggagatgagcgg
tcagagtctccctatgaaagtgctgatgaaactcagactgaagtgtctatatcatccaaa
aaatctgagcgaggagcaggaacaaaaaaagaatatgtgtgtcagctgtgtgaaaaaaca
ggtgatctcctactgtgtgaaggactttgctatcgagcttttcatgtaagctgccttggc
ctctctggaagaccagcaggaaaattcatttgtagtgaatgtacatcaggtgtgcatacc
tgttttgtgtgtaaggagagaaaggcagatgtgaaacgctgcgtcgtatcccattgtgga
aaattctaccatgaagcttgtgtgaaaaaatttcatcttactgtgtttgagaacaggggg
tttcgatgtcctctccacagctgcctgagttgtcatgttagtaaccccttacatccacga
atttcaaaaggaaagatgatgcgttgtgttcgctgtcctgttgcataccatgctggagac
gtttgcattgccgcgggatgtgcagtcatcgcttccaacagcattgtttgtacgaatcat
ttcactgccatgaaaggaaaaagtcatcatgcgcatgtcaatgtgagctggtgctttgtg
tgttcaaaaggaggaagcttgttgtgctgcgagtcatgtcctgcagcgtttcacccagac
tgtttaaacattgaaatgccagatgggagctggtactgcaatgactgcagggcagggaag
aagctccatttccaggatattatttgggttaaactgggaaattacagatggtggcctgca
gaagtttgccatccgaaaaacgttcccccaaatatccagaaaatgaagcatgaaatcgga
gaatttcctgtgtttttctttggttctaaggattactattggacgcaccaagcacgggtg
ttcccttacatggagggagacagagggagtagataccacgggatcaaaggaattggaaaa
gtcttcaaaaatgctttgcaagaagctgaagctcgatttcgagaaataaagctacagcga
gaagccaaagaaacccaagaaagtgaacgtaaacctccaccgtacaagcatattaaggtc
aataaaccttgtggtaaagtgcagatatatactgctgacatttctgagattcccaagtgc
aactgcaaacccacagatgaaaacccttgtggctttgactctgagtgcctaaatcggatg
ctgatgtacgaatgccatccacaagtttgtccagctggagaacggtgccaaaaccagtgc
tttacgaaacgtcagtaccctgagacaaagatcatcaaaactgacggcaaagggtggggt
ctggttgctaagagggacattaaaaagggagagtttgtgaatgagtatgttggtgaactc
attgatgaagaggaatgtatggcaagaatcaaatatgcacatgaaaatgacatcacccac
ttctatatgcttactattgataaggaccgtattattgatgctggccccaaaggaaattat
tctcggtttatgaatcacagctgccaaccaaattgtgaaaccctaaaatggacagtaaat
ggagacacccgtgtcggcctgtttgctgtgtgcgacattcctgcaggtacagagttgact
tttaattacaaccttgactgtctgggcaatgaaaaaacagtctgcaaatgtggtgcccca
aactgcagtggatttcttggggacagaccaaagaattcttccactaatgcctcagaagaa
aaaggcaaaaagaccaaaaagagaacacggagacgcagaacgaaaaatgaagggaagaaa
caatctgaagatgattgtttccgttgtggtgatggaggccagctggtattgtgcgacagg
aaatcttgtactaaagcttatcatctctcctgtcttggtttggtgaaacgtccttttggg
aagtgggagtgtccttggcaccactgtgatgtttgtggcaaaccttctgtttctttctgc
cacttctgcccaaattctttctgcaaggaacaccaagatgggacagtactaaattctatg
ttgaatggacagttatgctgctctgaacatgttctcggggtggattctgttgaaactcag
aagtctgagaaaccccgcaaaaaactgaacaagttgaagcctaagagaaagcagaggaac
agatggatgagagctgaatgcaaatag

DBGET integrated database retrieval system