KEGG   Francisella philomiragia O#319-029: BF30_1130Help
Entry
BF30_1130         CDS       T03617                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fpi  Francisella philomiragia O#319-029
Pathway
fpi00250  Alanine, aspartate and glutamate metabolism
fpi00410  beta-Alanine metabolism
fpi00430  Taurine and hypotaurine metabolism
fpi00650  Butanoate metabolism
fpi01100  Metabolic pathways
fpi01110  Biosynthesis of secondary metabolites
fpi01120  Microbial metabolism in diverse environments
fpi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:fpi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BF30_1130
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BF30_1130
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BF30_1130
   00430 Taurine and hypotaurine metabolism
    BF30_1130
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BF30_1130
Enzymes [BR:fpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BF30_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJI47993
LinkDB All DBs
Position
1133276..1134616
Genome map
AA seq 446 aa AA seqDB search
MALHAKNDMKHKLYKESLPKFEIPKKSNDAFEAYQQIKDELMLDGNSKQNLATFCQTEVD
DFIHRLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAENAIGCSTTGSSEAAML
GGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSNESLIMTPE
TMLKYCDENTIGVVPTLGVTFTGQYEPVEAVCEALDKFERDTGIDIPVHVDAASGGFLAP
FVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVVWADKKYLPQDLIFNVNYLGGDMPT
FALNFSRPGGQIVAQYYNFVKLGFEGYKNIHKLSYDVAKYIAKEIKDMGIFDIIHAGKGG
IPAVSWSLKAGKSYDLFDISEKIRARGWQIAAYSMPKDRQDLVVMRVLVRRGFSFDLAEL
MIRDLKNVINSLDNKSKDIERGGFSH
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcgttacatgccaaaaatgacatgaaacataagttgtataaagaatcattaccaaaa
tttgaaattcccaaaaaatcaaatgatgctttcgaagcatatcaacaaatcaaagatgag
ctaatgctcgatggtaattcaaagcagaatttagcgacattttgtcaaacagaagttgat
gatttcattcataggcttatggatgattgcattgataagaatatgattgataaagatgag
tatcctcaaactgctgaaatagagtcacgatgtgtcaacatactagcaaacctatggaac
tcttcagcagaaaatgcaatcggctgttcaactactggctcatctgaagcagctatgctt
ggcggtatggcaatgaagtggcgctggcgtgataagatgaaagcacaaggtaaagattat
acaaaacctaatcttgttacaggacctgtgcaagtctgctggcataaattcgctagatat
tgggatattgagcttagagagattccaatgtcaaatgaaagtttaataatgactccagaa
actatgcttaagtactgtgatgaaaatacaattggagttgtgccgactttaggggttacc
tttacaggtcagtacgagcctgttgaggcagtttgtgaagcacttgataaatttgagaga
gatactggtattgatattccagtgcatgtagatgctgcttctggaggatttttggcacca
tttgtagagcctgaacttaagtgggattttagattaccaagagttaagtcaattaattca
tcaggacataagtttgggttatcgccattaggagtgggttgggttgtttgggcagataag
aaatacttacctcaagatttgatttttaatgttaattatcttggtggtgatatgccgaca
tttgctttgaatttctctcgacctggtggtcagatagttgcccagtattataactttgtt
aagcttggttttgaaggatataaaaatattcataagcttagttatgatgttgcaaaatat
attgctaaagaaattaaggatatgggtatctttgatattattcatgctggtaaaggtggt
atcccagcagtgagttggtcacttaaggcaggcaaaagttatgatttgtttgatatctct
gaaaaaattcgtgctagaggttggcagatagctgcttattcgatgccaaaagatagacaa
gacttggtagttatgcgagtgcttgttaggagaggctttagctttgatttagcggagctt
atgattagggatctaaaaaatgttattaattctttagataataaatctaaagatatcgaa
agaggtggtttttcgcattag

DBGET integrated database retrieval system