KEGG   Flavonifractor plautii: A4U99_06470Help
Entry
A4U99_06470       CDS       T04429                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
fpla  Flavonifractor plautii
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:fpla00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    A4U99_06470
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A4U99_06470
Enzymes [BR:fpla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     A4U99_06470
Bacterial toxins [BR:fpla02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   A4U99_06470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1343968..1346091
Genome map
AA seq 707 aa AA seqDB search
MKQHKRLPLALFLVFALCIQTLSFTSAAAALADPEPVFSASDMTFSSGTDAVALPQSAVT
QLSGLSSGTIIVDFTPTAMSTANCLFSLSNSSVTDAYFNLYIDNRGFLGLEVRNHGETRY
VNLQGPAEVTRNTRHIMALSADPQEGYKFYFDGDMVFQMPVALYELWEYDYRFMSTVNSA
DVGYMGATYRNGSFGYPYYGTIDSVRVYDTALAQDVLEAETYIEKDSEIIRQENVFSFED
WNTEGIRIPSILRTDKGTIIATGDIRFGDAAGASNDPPNNCDIGIRVSSDDGATWSQPKM
LLNFLDYPNEPQVPMKTDSASYCDSLLVKGQNGRVFFFCDAMTGNVRAPYAAASTGYTSD
GYLILKDSAGTQYELHEDDGTVYLNGAATDYTVGPDFTLYKNGQEAGNIFYTNYGTYDAS
AVPRKTELRVINTVFLIMCYSDDGGYTWSDPKLMNYGFKTSDMKHFGTAPGIGIVIQTGK
YQGRILVPLYYNSNSFSGMSGAVLYSDDNGATWHLGESPNDARAAAGLSKIGMGEIQIVE
MPPEGDDVSTQLKMFVRQSGGVLIATSYDGGQTWAPDMPRDPTLVAPTPYGGCQQSVINY
SHPIDGKPAVIFANAAANSRSNGTIRIGLINENGTNSEGRINYTFDWKYKKVIRSGEFGY
SCLMEQPNGNIVCFYEQESRPDNIHSLVFGEYTLDYIKDIKPMNVSY
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacataagagactgccgctagcactttttctggtgtttgcactttgcatccag
actctgtcgttcaccagcgcggctgctgccttggctgaccctgagccggtgttctcggcc
agcgatatgacgttttccagtggcacggatgccgtcgctctcccccagagcgctgtcacg
caactctctgggttgtcgagcggcacaatcatcgtggacttcacccccacggcgatgtcc
acggccaactgcctgttcagcttgagcaacagcagcgtgactgacgcctactttaacctt
tacattgacaaccggggcttcctgggcctggaggtcaggaatcatggggagacccgctat
gtgaatctccagggtccggcagaggtcacgcgcaatacccggcatatcatggcgctcagt
gcggacccacaggaaggctacaagttctattttgatggcgacatggttttccaaatgcct
gtggccctttatgagctatgggagtacgactaccggttcatgtccacagtgaattccgcc
gatgtgggctatatgggtgcaacctatcggaacgggtcattcggatatccctactacggc
accatcgacagcgtgcgtgtctatgatacggctctggcacaggatgttctcgaggcagaa
acctacatagagaaggactctgaaatcatcaggcaggagaatgtgttctcttttgaggat
tggaacacagagggcatccgaatcccctccattctgcggaccgacaaggggacgatcatt
gccacgggcgatatccggttcggcgacgccgccggagcgagcaacgatcctcccaacaac
tgcgacatcggcatccgggtcagtagcgatgacggcgcaacctggagccaacccaaaatg
ctgctcaattttcttgactaccccaacgaaccccaggtccccatgaaaacggacagcgca
tcttactgcgattcgctcctcgtcaaaggtcaaaacgggcgggtcttcttcttctgtgac
gcgatgaccggaaacgtccgtgcgccctatgcagcggcctctaccggctatacttctgac
ggctatctgatcctaaaggactcggctggcacccaatatgagctgcacgaagatgacggg
acggtgtatctaaatggggcggcaaccgactacacagtcggacctgatttcaccctttat
aaaaatggacaggaagctggaaacattttttacaccaactacggaacctacgacgcatcc
gcagtaccgcgcaaaacggaactgcgggtcatcaatacggtcttcctgatcatgtgctac
agcgatgacggcggctatacctggtcagatcccaaactgatgaactacggctttaagacc
agtgatatgaagcactttggcacagcccccggcattgggatcgtcatccagaccggcaaa
taccaaggccgcatccttgtgcccctttactataacagcaattctttcagcggtatgagc
ggcgcagttctttacagcgatgacaatggggcaacctggcacctgggtgaatctccaaac
gacgctagagcggctgcgggcctttcaaaaatcggtatgggtgaaattcaaatcgtagaa
atgccaccggagggtgatgatgtttctacccagctaaagatgttcgtgcgccagtcaggc
ggcgtattaatcgctaccagctatgatggtggccagacctgggcgcccgatatgccgagg
gacccgacgctggtggcgcccacaccctatggaggctgccagcagtctgttatcaactat
agtcatccaattgatggaaagcccgccgttatcttcgccaatgcggcagccaatagccgc
tccaacggcacgataagaatcggcctgatcaatgagaacgggaccaattcagaggggcga
atcaactacacgtttgattggaagtacaaaaaagtaattcggtcgggtgaatttggctat
tcctgcttgatggagcagcccaatgggaatattgtttgcttctatgagcaagagagtcgg
cctgacaatatccattccctggtcttcggtgaatacacactcgactacatcaaggacatc
aaacctatgaatgtttcatattag

DBGET integrated database retrieval system