KEGG   Frankia sp. EAN1pec: Franean1_4274Help
Entry
Franean1_4274     CDS       T00608                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
fre  Frankia sp. EAN1pec
Pathway
fre00020  Citrate cycle (TCA cycle)
fre00480  Glutathione metabolism
fre01100  Metabolic pathways
fre01110  Biosynthesis of secondary metabolites
fre01120  Microbial metabolism in diverse environments
fre01130  Biosynthesis of antibiotics
fre01200  Carbon metabolism
fre01210  2-Oxocarboxylic acid metabolism
fre01230  Biosynthesis of amino acids
Module
fre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fre_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Franean1_4274
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Franean1_4274
Enzymes [BR:fre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Franean1_4274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH HemN_C
Motif
Other DBs
NCBI-ProteinID: ABW13658
RhizoBase: Franean1_4274
UniProt: A8L9F5
LinkDB All DBs
Position
complement(5108256..5110475)
Genome map
AA seq 739 aa AA seqDB search
MTDSVIIYTQTDEAPALATYSFLPVVQAYASTAGVGVVSRDISLAGRIIASFPEHLEPSQ
RIDDALAELGDLARTPEANIIKLPNISASIPQLRAAVVELQKQGYALPDYPDDPKTDEER
EIRARYDKVKGSAVNPVLREGNSDRRAPASVKSYAKAHPHRMGAWSVESKTNVATMSADD
FRSTEKSAVIAADGSLRIELVGDDGTTSVLRESVPVLASEVVDVSVMRVGALREFLTEQV
ARAKAEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPETFARHGAALAAAGLTPNEGLGGI
FKGLEALPEGAEIKASFEAELAAGPPLAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGAEADTLAVLPDSSYAGIYQAVIDDCRAHGAYDPATMGSVPNVGLMAQKAEEYGS
HDKTFEIPTTGTVRLVDGAGTAVLELTVSAGDIFRACQTKDAPIRDWVKLAVTRACATGN
PAVFWLDETRAHDAQLITKVRTYLADHDTTGLQIEIKAPVDAITFSLERIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFLALAVSFEHLAQRTGNARAQVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LALYWAQELAAQTDDAALAQAFTSLAESLAAQEKTIVDELLAVQGSPADIGGYYQPDPAK
AAAVMRPSKTFNEAIATLA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgattcggtgatcatctacacccagacggacgaggcgccggcgctggcgacgtac
tcgttcctgccggtggtgcaggcgtacgcgtcgacggccggggtcggcgttgtcagccgc
gacatttccctggccgggcggatcatcgccagcttcccggagcacctcgagccgtcccag
cgcatcgacgacgcgctcgccgagctcggcgacctggcccgcacgcctgaggcgaacatc
atcaagctgccgaacatctcggcgtccatcccgcagctgcgggccgccgtcgtcgagctg
cagaagcagggctacgcgctgccggactaccccgacgacccgaagaccgacgaggagcgg
gagatccgcgcccgttacgacaaggtcaagggcagcgccgtcaaccccgtgctgcgcgag
ggcaactccgaccgccgcgcgccggcgtcggtgaagagctacgccaaggcccacccgcac
cgcatgggcgcctggagcgtcgagtcgaagacgaacgtcgccaccatgagcgccgacgac
ttccgttcgaccgagaagtccgcggtgatcgccgcggacggctccctgcgtatcgagctg
gtcggcgacgacggcaccacgtccgtcctgcgcgagtcggtaccggtgctcgccagcgaa
gtcgtcgacgtctcggtcatgcgggtcggcgcgctgcgcgagttcctcaccgagcaggtg
gcccgggcgaaggccgagggcgtgctgttctcggtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggccacgtcgtgcgtgcgttcttccccgagacgttcgcc
cgccacggcgcggcgctcgcggcggccggcctgaccccgaacgagggcctcggcggcatc
ttcaaggggctggaggcgctgcccgagggcgccgagatcaaggcctccttcgaggccgag
ctcgccgccgggccgccgctggccatggtcgactccgaccggggcatcacgaacctgcac
gtgcccagcgacgtcatcgtcgacgcgtccatgccggcgatgatccgcacctccggccac
atgtgggggccggacggtgccgaggcggacaccctcgccgtcctgcccgacagcagctac
gccggcatctaccaggccgtcatcgacgactgccgcgcgcacggcgcctacgacccggcg
acgatgggctcggtgcccaacgtcggcctgatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatcccgacgaccggcaccgtgcggctcgtcgacggagcgggc
acggcggtcctcgagctgaccgtgagcgcgggtgacatcttccgcgcctgccagaccaag
gacgccccgatccgcgactgggtgaagctcgccgtcacccgggcctgcgccaccggcaac
ccggccgtgttctggcttgacgagacccgcgcgcacgacgcccagctcatcaccaaggtc
cggacctacctggccgaccacgacaccaccgggctgcagatcgagatcaaggccccggtc
gacgcgatcaccttctcgctggagcggatccgccgcggcgaggacaccatctcggtgacc
ggcaacgtgctgcgtgactacctgaccgacctgttcccgatcctggagctcggcacgagc
gcaaagatgctctcggtcgtcccgctgatgaacggcggcggcctgttcgagaccggtgcc
ggcgggtcggcgcccaagcacgtccagcagctcgtcaaggagaactacctgcgctgggac
agcctgggtgagttcctggcgctggcggtgagcttcgagcacctcgcgcagcgcaccggc
aacgcccgcgcccaggtgctggccgacaccctcgaccgggcgaccgcgaccttcctcaac
gaggacaagtcgcccacccgccgggtcggcggcatcgacaaccggggcagccacttctac
ctggccctgtactgggcccaggaactcgcggcgcagaccgacgacgccgcgctcgcgcag
gcgttcaccagcctggccgagagcctcgcggcccaggagaagaccatcgtcgacgagctg
ctcgccgtgcagggctcgccggccgacatcggcggctactaccagcccgacccggccaag
gccgcggccgtgatgcgcccgtcgaagaccttcaacgaggccatcgcgacgcttgcctga

DBGET integrated database retrieval system