KEGG   Francisella sp. TX077308: F7308_1221Help
Entry
F7308_1221        CDS       T01560                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
frt  Francisella sp. TX077308
Pathway
frt00240  Pyrimidine metabolism
frt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    F7308_1221
Enzymes [BR:frt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     F7308_1221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 ResIII
Motif
Other DBs
NCBI-ProteinID: AEI36147
UniProt: F8G738
LinkDB All DBs
Position
1251881..1252474
Genome map
AA seq 197 aa AA seqDB search
MAKLYFRYSAMDAGKTLDLLKVAYNYEDRGRKPLVLTSAIDKRAGLNKVKSRIGIDQDAY
SLTDQDNIFEFIKEYNKKHKIDCVLIDEIHFFTQEQVWQLSDVVDLMDIPVICYGLRTNY
LGQPFETSALLLAIADTLEEVKTICFCGKKASFNMMVQNGKAVKEGNPIVVDDDSLKDID
TKYVSVCRKHWKKGEYQ
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaattatattttagatattcagcaatggatgctggtaaaacattagatctttta
aaagtggcttataattatgaggatagaggtagaaaacctttggttttaacttctgcgata
gataagcgagcaggattaaataaggtcaagtcacgcataggtatagatcaagatgcttat
tctttgacagatcaggataatatatttgagtttattaaagaatataataaaaaacacaaa
atagactgtgtattgatagatgaaatacatttttttactcaagagcaagtttggcaactt
tctgatgttgttgatttaatggatatacctgttatatgttatgggcttcgtacaaactat
ttgggccaaccctttgaaacttcggctttattacttgcaattgctgatactttagaggag
gttaaaactatatgtttctgtggtaaaaaagctagttttaatatgatggtgcaaaatggt
aaagctgtaaaagaaggaaatccaatagttgttgatgatgattctctaaaagatattgat
acaaaatatgtttcagtttgtcgtaaacactggaaaaagggtgaataccagtaa

DBGET integrated database retrieval system