KEGG   Francisella sp. TX077310: F7310_09705Help
Entry
F7310_09705       CDS       T05017                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
frx  Francisella sp. TX077310
Pathway
frx00250  Alanine, aspartate and glutamate metabolism
frx00410  beta-Alanine metabolism
frx00430  Taurine and hypotaurine metabolism
frx00650  Butanoate metabolism
frx01100  Metabolic pathways
frx01110  Biosynthesis of secondary metabolites
frx01120  Microbial metabolism in diverse environments
frx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:frx00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    F7310_09705
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    F7310_09705
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    F7310_09705
   00430 Taurine and hypotaurine metabolism
    F7310_09705
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    F7310_09705
Enzymes [BR:frx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     F7310_09705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC YPEB BssS Topo_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: API87611
UniProt: A0A1L4BUU1
LinkDB All DBs
Position
complement(2102704..2104047)
Genome map
AA seq 447 aa AA seqDB search
MALHGKKNIMDDFDFFEESLPKVRIPVGSQDPLQTYQEIKDELMLDGNSKQNLATFCQTQ
VDDFSHKLMDDCLDKNMIDKDEYSQTAEIESRCVNILANLWNSSAESAIGCSTTGSSEAA
MLGGMAMKWRWRDKMKAQGKDCSKPNLVTGPVQVCWHKFAKYWDIELREIPMSKESLIMT
PEAVIERCDENTIGVVPTLGVTFTGQYEPVEEVCKALDKFEQETGIDIPVHVDGASGGFL
APFIDPELKWDFRLPRVKSINASGHKFGLSPLGVGWVIWSDKKYLPDDLVFNVNYLGGDM
PTFALNFSRPGGQIVAQYYNFVRLGFEGYRKVHQVSYDVTKYIAGQLDDMGIFEIIHSGQ
GGIPAVSWSLKSDKEYSLFDLSEKIRSKGWQIAAYSMPKDRQDLVVMRVLVRRGFTFDLA
QLMIRDLKKAIQSLENKESNNRSSFSH
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggctttacatggtaaaaaaaatataatggatgactttgacttttttgaagagtcttta
ccaaaagttagaatcccagtagggtcacaggatccacttcaaacatatcaagagataaaa
gatgagttaatgttagatggtaactcaaagcagaatctagctactttttgccaaactcaa
gttgatgatttttcacataagcttatggatgattgtcttgataagaatatgattgataaa
gatgaatattcacaaactgcagagatagaatcaagatgtgttaatattttggcaaattta
tggaactcttcagcagagagtgctattggttgctcaactactggttcatctgaagctgcg
atgcttggtggtatggcaatgaaatggcgttggcgtgataaaatgaaagcccaaggtaaa
gactgttcaaagccaaatttagttacaggtcctgttcaagtttgttggcataaatttgca
aaatattgggatatcgagcttagagaaatacctatgtctaaagaaagtctaataatgact
ccagaagcagttatagaaagatgtgatgaaaatacaataggtgtagttccgacattagga
gttacatttacagggcaatatgagcctgttgaagaggtttgtaaagctttagataagttt
gagcaggaaactggcattgatattcccgtacatgtagatggcgcttctggaggctttctt
gccccatttatagatcctgagcttaaatgggattttaggctacctcgagttaagtcaatt
aatgcgtctggacataaatttggtttatcgccattaggtgttggttgggttatttggtcg
gataaaaagtacttaccggatgatttagttttcaatgtgaattacttaggtggtgatatg
cctacttttgcactgaatttttctcgacctggagggcaaatagttgctcaatactataat
tttgttaggttgggttttgaagggtacagaaaagtgcatcaagttagctatgatgttaca
aaatatattgctggacagcttgatgatatgggtatttttgagattattcatagtggtcaa
ggaggtattcctgcagtgagttggtctcttaagtctgataaagagtatagtttgtttgat
ttgtctgaaaagattcgttcaaaaggctggcaaatagcagcgtactcaatgcctaaagac
aggcaagacctagttgtgatgagagttttagtcagaagaggatttacttttgatttagct
cagctaatgattagagatttaaaaaaagcgattcaatcacttgaaaacaaagaatctaat
aataggtctagtttttcacactaa

DBGET integrated database retrieval system