KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1791Help
Entry
FTL_1791          CDS       T00331                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Brite
Enzymes [BR:ftl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     FTL_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1724094..1724672)
Genome map
AA seq 192 aa AA seqDB search
MKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIVKTS
NGGIFNNAAQVFNHTFYWNCLTPNKTEASSQLKAALIETFGSVENFKEQFSKAAIATFGS
GWAWLVKNTEGKLEIVTTSNAGCPLTENKKPLLTFDVWEHAYYIDYRNARPKYVEALWDI
VNWQFVSEQFAD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaattaccaaaactaccttacgctgttgatgcattagagtcaacaatatca
aaagaaacaatagagtatcactatggtaaacatcatcaaacatatgtaactaatctaaat
aatttagttgagggtacagagcacgatggcagaaacctagaagaaatcgtaaaaacttct
aatggcggaatatttaataacgctgctcaagtttttaatcatactttttactggaattgt
ttaactccaaacaaaacagaggcttcaagtcagttaaaagcagcattgatcgagacattt
ggttctgtagaaaattttaaagaacaattctctaaggcagctattgcaacatttggttct
ggttgggcttggttagtaaaaaatactgaaggtaaacttgaaatagtaactacaagtaac
gctggttgcccattaacagagaacaaaaagccattgctaacttttgatgtttgggagcac
gcatactatattgattatcgtaatgctagacctaaatatgttgaagcattatgggatatc
gtaaactggcaatttgtttctgagcaattcgctgattag

DBGET integrated database retrieval system