KEGG   Francisella tularensis subsp. tularensis SCHU S4 NR-28534: RO31_2047Help
Entry
RO31_2047         CDS       T03888                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ftq  Francisella tularensis subsp. tularensis SCHU S4 NR-28534
Pathway
ftq00250  Alanine, aspartate and glutamate metabolism
ftq00410  beta-Alanine metabolism
ftq00430  Taurine and hypotaurine metabolism
ftq00650  Butanoate metabolism
ftq01100  Metabolic pathways
ftq01110  Biosynthesis of secondary metabolites
ftq01120  Microbial metabolism in diverse environments
ftq02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ftq00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RO31_2047
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RO31_2047
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RO31_2047
   00430 Taurine and hypotaurine metabolism
    RO31_2047
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RO31_2047
Enzymes [BR:ftq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     RO31_2047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AKE21796
LinkDB All DBs
Position
complement(1792648..1793994)
Genome map
AA seq 448 aa AA seqDB search
MALHGKKDTIDNLDFFEQSLPKFKLPLNSQDPLEVYQEIKDELMLDGNSKQNLATFCQTE
VDDFIHKLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAENAIGCSTTGSSEAA
MLGGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSNESLIMT
PEAVLERCDENTIGVVPTLGVTFTGQYEPVEQVCKALDDFERQTGVDIPVHVDAASGGFL
APFVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVIWADKKYLPDDLIFNVNYLGGNM
PAFALNFSRLGGQIVAQYYNFVRLGFEGYKKVHQLCYDVAEYIAKELRKMEIFEIIHAGE
GGIPAVSWSLKATKEYSLFDISEKVRAKGWQIAAYTMPNNREDLVVMRVLVRRGFSYDLA
QLMIRDLVAVIDSLEGKLKILKRSSFAH
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcattacatggtaaaaaagatacaattgataaccttgatttttttgaacaatcttta
ccaaagtttaaacttccactaaattcacaagatcctttagaagtgtatcaagaaatcaaa
gatgagttaatgctagatggtaattcgaagcaaaatttagcgacgttttgccaaacggaa
gttgatgacttcattcacaagcttatggatgattgcattgataaaaatatgattgacaaa
gatgaatatccgcagactgcggaaatagagtctcgctgtgtaaatatccttgcaaaccta
tggaactcttcagcagaaaatgcaattggctgctcaacgactggctcatcagaggctgct
atgcttggcggtatggcaatgaagtggcgttggcgagataaaatgaaagcgcaaggtaaa
gattatacaaaacctaatcttgttacaggacctgtgcaagtgtgctggcataaatttgct
agatattgggatattgagcttagagaaattccaatgtcgaatgaaagtttaataatgact
ccagaggctgtgcttgaaagatgtgatgaaaatacaatcggtgtggtgccaactcttgga
gtgacttttacagggcagtatgagccagtagaacaggtatgtaaagctcttgatgatttt
gaacgacaaacaggcgtagatattccagttcatgttgatgcagcatctggaggttttttg
gcaccatttgtagagcctgaacttaagtgggactttagattaccaagagttaagtcaatt
aactcatcaggacataagtttggtttatcgccacttggggttggttgggttatttgggct
gataaaaagtacttaccagatgatttgatttttaatgttaattacctaggtggtaatatg
ccagcatttgcactgaatttctcgcgacttggtggtcagatagtagcccagtattataat
tttgttaggttgggttttgaaggctataagaaagttcatcagctttgctatgatgttgca
gaatatattgctaaagagcttagaaaaatggaaatttttgaaattattcatgctggagag
ggtggtattcctgcggttagctggtcacttaaagcaactaaagagtatagtttgtttgat
atatctgagaaagttcgcgctaaaggttggcaaatagcagcttacacaatgccaaacaat
cgtgaagatttagtggttatgcgtgtattagttagaagaggctttagttatgacttggca
cagttgatgattagagatttagttgcggtgattgattcattagagggaaagttaaaaata
ttaaaaaggagtagttttgcacattag

DBGET integrated database retrieval system