KEGG   Fragaria vesca (woodland strawberry): 101297661Help
Entry
101297661         CDS       T02666                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101297661
   00051 Fructose and mannose metabolism
    101297661
   00052 Galactose metabolism
    101297661
   00500 Starch and sucrose metabolism
    101297661
   00520 Amino sugar and nucleotide sugar metabolism
    101297661
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101297661
Enzymes [BR:fve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101297661
Membrane trafficking [BR:fve04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101297661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
LG1
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAVTCAAAALLVRRRLKSSRRWARAMAILKEFEEKCDTPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKEKR
VIKQEFDEVSIPPHLMTGTSEGLFDFIAEALAKFVATEGEGFHPAPGRLRELGFTFSFPV
WQTSIASGTLIKWTKGFSIEDAVEQDVVAELTKSVEKIGLDMRVTALVNDTIGTLAGGRY
HNPHVIAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPHTEYDQ
ALDAESLNPGEQIFEKIISGMYLGDIVRRVLLKMAEEAAFFGDTVPHKLKIPFVLRTPDM
SAMHHDSSPDLRVVGSKLKDILEISNTSLKVRKAVVALCDIVATRGARLSAAGILGVLKK
LGRDTVKDGEKHKSVVALDGGLFEHYTEFRVCMESTLDELLGDDVAEHISVEHSNDGSGI
GAALLAASHSHYLGVEDS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcggtgggggcggcggtggtgtgcgcggcggtgacgtgtgcggcggcg
gcgctgctggtgcggcggagattgaaaagctcgaggaggtgggcccgggcgatggcgata
ttgaaggagtttgaggagaagtgtgacacgccgattgggaagctccggcaggtggctgac
gccatgacagtggagatgcacgccgggctggcgtcagagggcggcagcaagcttaagatg
ctcatcagctatgttgataacctccccactggggatgagaaaggactattttatgcatta
gaccttggtgggacaaatttccgtgtcctgcgcgtacagcttggtgggaaagaaaagcgt
gttattaaacaagaatttgacgaagtttcaattccaccacatttgatgactgggacttca
gaaggattatttgattttattgctgaagcactagcaaaatttgtggctactgaaggagaa
ggttttcatcctgcacctggtagactaagggagctgggttttaccttctcatttcccgtg
tggcaaacatcaattgcatcaggaacccttatcaagtggacaaaaggattcagtattgaa
gatgcggttgagcaagatgtggtggcagagctcaccaaatcagtggaaaaaattggcctg
gatatgcgtgttacagctttggtcaatgatacaattgggacattagctggaggtaggtac
cacaatccgcatgtaattgctgctgtcattttgggcaccggaacaaatgcggcttatgta
gaacgtgcacatgcgattccaaaatggcatggtcttctacctaaatcaggagagatggta
atcaacatggagtggggtaactttcgttcatcacaccttccccatacagaatatgatcaa
gcccttgatgctgagagtttgaaccctggagagcagatctttgagaagattatttctggg
atgtacttaggagacattgtgcgcagagttttgttgaagatggctgaagaagctgccttt
tttggtgatactgttccacacaaactgaaaattcccttcgtattaaggactcccgacatg
tccgcaatgcatcatgactcatctccggatctgagagtggttgggagcaaactgaaggat
atcttagagatctccaatacgtcactgaaagtgagaaaggccgttgtggcgttatgtgac
atagttgccactcgtggagcccgcctctccgctgctgggatcctgggagtccttaagaag
ttgggtagagacacggtaaaggatggagagaagcacaagtcagtggtagcattggatggt
ggcttgtttgagcactacactgaattccgagtctgcatggagagtactcttgatgagttg
ttgggtgatgatgtcgccgagcacatatctgttgagcactcaaatgatgggtccggaatt
ggagctgctctcctggcagcctctcactcccattaccttggggtagaggattcgtaa

DBGET integrated database retrieval system