KEGG   Fragaria vesca (woodland strawberry): 101303987Help
Entry
101303987         CDS       T02666                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101303987
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101303987
Enzymes [BR:fve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     101303987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
LG4
AA seq 190 aa AA seqDB search
MFLYKSHCAVFFVKQKMSASIFKSPVPASGYVGLATSPSKIFPAKDSIGWTKKTVSNCSR
TCCMKSWNPINNKKFETLSYLPPLSDDSIAKEIDYMLKKGWIPCLEFDEVGYVQRENSRM
PGYYDGRYWTLWKLPMFGCIDPSLVLNEIQECKKTYPNAYIRCVAFDNQNQGQCMAFIIQ
KPNIAATTSA
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttacaaatcacactgtgctgtgttctttgttaaacagaagatgtctgcttct
atcttcaaatctcctgttcctgcatctggttacgttggcttagcaaccagcccttccaaa
attttcccagctaaagactctatcggatggaccaagaaaactgtctccaattgttcaaga
acttgctgcatgaagtcatggaatccgatcaacaacaagaagtttgaaactttgtcttac
ctcccaccactctctgatgattcaattgcaaaggagattgactacatgctcaagaagggg
tggatcccttgccttgaatttgacgaggtgggatatgttcaaagggagaatagcaggatg
ccagggtactatgatggaagatattggacgttgtggaagctacccatgtttggttgcatt
gacccttctctggtgctcaatgaaatccaagagtgcaagaaaacgtacccaaatgcttat
atacgttgtgtagcatttgacaaccagaaccagggtcagtgcatggcctttatcattcag
aagccaaacattgcagccaccaccagtgcttga

DBGET integrated database retrieval system