KEGG   Fusarium verticillioides: FVEG_09655Help
Entry
FVEG_09655        CDS       T04869                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00250  Alanine, aspartate and glutamate metabolism
fvr00410  beta-Alanine metabolism
fvr00430  Taurine and hypotaurine metabolism
fvr00650  Butanoate metabolism
fvr01100  Metabolic pathways
fvr01110  Biosynthesis of secondary metabolites
Module
fvr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fvr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    FVEG_09655
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FVEG_09655
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FVEG_09655
   00430 Taurine and hypotaurine metabolism
    FVEG_09655
Enzymes [BR:fvr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FVEG_09655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 30067296
NCBI-ProteinID: XP_018756622
UniProt: W7MHW0
LinkDB All DBs
Position
1
AA seq 580 aa AA seqDB search
MSLVQHSSSEAASPVPIIETDDQGRPVKSTSTNGYFPSSSGQHLPSSANGTVTPSFIDNM
SHLSVVRARDDSDAASVRSTSSRTSRKPQMQLASYQDEFTTSVYGSRFAGMDLPRHHMPE
NEMPRDIAYRMIKDDLSLDNNPMLNLASFVTTYMEDEAEKLMAESFSKNFIDYEEYPQSA
DIQNRCVNMIGDLFHAPPGESVGTSTVGSSEAIMLAVLAMKKRWKNRRQAEGKSTEHPNI
VMSSAVQVCWEKATRYFEIDEKLVYCTPDRFVMDPDEAVDLCDENTIGMCAILGTTYTGE
YEDIKAINDLLVERNLDVPIHVDAASGGFVAPFVVPDLEWDFRCEKVVSINVSGHKYGLV
YPGVGWVIWRSPEYLPQELVFNINYLGADQSSFTLNFSKGASQVIGQYYQLIRLGKHGYR
AIMSNLTRTADYLTETLENLGFVIMSERSGAGLPLVAFRFKTVEEGGDPDRYYDEFALAH
HLRSRGWVVPAYTMAPNSGVKMLRVVVREDFTKSRCDQLICDVKLCHGLLKETDQESIKK
REEYIRNHISAMGRGKHAHPVYKGESHSLQGKTGKTHAIC
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcgtacaacattcttcaagtgaggctgcctcacctgttcccatcatcgagaca
gacgaccaaggaagacccgtgaaatcaacaagtacaaacggttacttcccctcctccagc
ggccaacatcttccttcttctgccaacggaactgttactccttcgttcatcgacaacatg
tcccatctctctgttgtccgtgcgagagacgactctgacgctgcgtctgtccgctccacg
agctctcgcacctcgagaaagccccagatgcagcttgcgagctatcaggatgagttcacc
accagcgtctacggctctcgctttgcgggcatggatctccccaggcatcatatgccagag
aatgagatgccccgcgacattgcgtatcgcatgatcaaggatgatctgagtctcgacaac
aaccccatgctcaacttggcgtcttttgttactacttacatggaagatgaagccgaaaag
ctcatggctgagtccttctccaagaacttcatcgattacgaagagtaccctcaatccgcc
gacattcagaaccgctgtgtcaacatgatcggcgatcttttccacgcgcctcccggcgaa
tcagtcggtacatccactgttggttcatcagaagctattatgctcgctgtcctggccatg
aagaagcgctggaagaaccgcaggcaagctgagggaaagagcaccgagcaccccaacatc
gtcatgtcatctgctgtgcaggtctgttgggaaaaggccactcgttatttcgagattgac
gagaagctcgtctactgcactcctgatcgattcgtcatggatcctgatgaggctgttgat
ctgtgtgacgagaataccattggcatgtgtgctattctcggaactacttacactggcgag
tacgaggatatcaaggccatcaacgatctcctcgttgagcgaaaccttgatgttcctatt
cacgtcgatgctgccagtggcggttttgtcgctccattcgtggtccccgacctagaatgg
gatttccgatgtgaaaaggttgtttccatcaacgtttcaggtcataagtacggtcttgtg
taccctggtgttggttgggtcatctggcgatctcccgagtatcttcctcaagagctcgtc
ttcaacatcaactacctcggagctgaccaatcctctttcaccctcaacttctccaagggt
gcatcacaggtcattggccaatactaccagctcatccgtctcggaaagcatggttaccgt
gctatcatgagtaaccttacccgtactgccgactacctgacagaaaccctggagaacctg
ggtttcgtcatcatgtcagaacgatctggagctggtctccccctcgttgccttccgattc
aagactgttgaagagggcggtgatcctgatcgctactacgatgagtttgctctcgcccac
cacctccgatctcgaggttgggtcgtccccgcttacaccatggctcccaactctggtgtc
aagatgttgcgtgttgttgtccgagaggactttacaaagagtcgatgtgaccagcttatc
tgtgatgtcaagctgtgccacggtcttctcaaggagacggatcaggagtctatcaagaag
cgtgaagagtacatcaggaatcatatttctgccatgggtcgtggaaagcatgcccaccct
gtttacaagggcgagtcgcattctctccagggcaagactggcaagacacatgctatttgc
tag

DBGET integrated database retrieval system