KEGG   Fusarium verticillioides: FVEG_12957Help
Entry
FVEG_12957        CDS       T04869                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
fvr  Fusarium verticillioides
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fvr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FVEG_12957
Enzymes [BR:fvr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     FVEG_12957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
11
AA seq 460 aa AA seqDB search
MKFSLLATIVASISPLARAADANAWKSRNIYFALTDRVARSADDNGGSACGNLGNYCGGT
FKGLESKLDYIKGMGFDAIWITPVVDNTDGGYHGYWAKDLYAVNSKYGTADDLKSLVKSA
HDKNMYVMCDVVANHMGKGISDHKPSPLNEQSSYHTPCDIDYSNQTSIEQCEIAGLPDLN
TGSDTVKKVLYDWIKWLVSEYSFDGIRIDTVKHVEKPFWPGFQDAAGVYAIGEVWDGGPD
YLAGYAQVMPGLLNYAMYYPMNRFYQQKGDPSDVVAMHDEISNKFPDPTILGTFIDNHDN
PRWLSQKNDKALLKNALAYVILARGIPIVYYGTEQGYAGGNDPANREDLWRSSFSTDADL
YQHISRLSKARSAVGGLGGNDHKHLYSQDSAYAWSRADGDLIVLTLNRGQGYSGQYCFNT
GKNNKTWDRVFGSGTVTSDGNGQVCVSYTNGEPEVLVASS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctctcttcttgcgaccatcgtcgctagcattagtccgcttgcacgcgcagca
gatgcaaacgcttggaagtcgcgaaatatttacttcgcacttactgatcgtgttgcgcgg
agtgctgatgataatggcggcagtgcatgcggaaacctcgggaattactgtggtggaact
tttaagggcttagagtcaaagcttgattatatcaagggcatgggatttgatgctatttgg
attactcctgttgttgacaatactgatgggggataccatggatactgggctaaggatctg
tatgcggtcaactccaagtatggtactgcagatgatttgaagagtcttgtcaaatctgct
catgacaagaacatgtacgtcatgtgcgacgtcgtcgcaaaccacatgggcaaaggcatc
tcagaccacaaaccctcccccctcaacgaacaaagctcataccacaccccctgcgatatc
gactacagcaaccagaccagcatcgagcagtgcgaaatcgccggtcttcccgacctcaac
accggcagcgacaccgtcaagaaagtcctctacgactggatcaagtggcttgtctccgag
tacagcttcgacggtatccgcatcgatacagtcaaacatgtcgaaaagccgttctggcct
ggttttcaagacgctgctggtgtttacgccatcggtgaggtttgggatggagggcctgat
tacctagctggttatgcacaggtcatgcctggtctcttgaactatgctatgtattacccc
atgaaccggttctaccagcaaaaaggcgatccttcagatgttgtcgctatgcacgatgag
attagcaacaaattccccgatcccactatcctcggaacattcatcgacaaccacgataac
cctcgctggttgagccaaaagaacgacaaagctctcctcaagaacgccctcgcatacgtc
atcctagcccgaggtattcccatcgtctactacggaacagagcaaggttacgctggcggc
aatgatcccgccaaccgtgaggatctctggcgaagcagcttcagcaccgacgcggatctg
tatcaacacatttcacgcctctccaaggctcgctcggcggtcggtggtcttggtggaaat
gatcacaagcatctctactcgcaggacagcgcgtatgcttggagtcgtgctgatggcgat
ctcattgttcttactttgaaccgcggacaggggtactcggggcaatactgctttaacact
ggaaagaacaacaagacttgggacagagtctttggaagtggaactgttacctctgatggc
aatggtcaggtttgtgttagctacactaacggcgagcctgaagtcttggttgcgtctagc
tag

DBGET integrated database retrieval system