KEGG   Gilliamella apicola: GAPWK_0385Help
Entry
GAPWK_0385        CDS       T03066                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
gap  Gilliamella apicola
Brite
Translation factors [BR:gap03012]
 Eukaryotic Type
  Elongation factors
   GAPWK_0385
 Prokaryotic Type
   GAPWK_0385
Mitochondrial biogenesis [BR:gap03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GAPWK_0385
Exosome [BR:gap04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GAPWK_0385
  Exosomal proteins of breast cancer cells
   GAPWK_0385
  Exosomal proteins of colorectal cancer cells
   GAPWK_0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
409739..410923
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITSVLSKKYGGQARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GDAEWEEKIVELANALDTYIPEPERDIDKPFLLPIEDVFSISGRGTVVTGRVERGVIKTG
EEVEIVGIKPTTKTTCTGVEMFRKILDEGRAGENVGILLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMADGLRFAIREGGRTVGAGVVAKVIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccccacgttaacgttggtacaatcggccac
gttgaccatggtaaaacaactttaactgcagctattacttctgtactttctaaaaaatac
ggcggtcaagctcgtgcattcgatcaaatcgataacgcaccagaagaaaaagctcgtggt
atcaccatcaacacttcacacgttgaatacgatacaccaactcgtcactacgcacacgta
gactgcccaggccatgctgactatgttaaaaacatgatcactggtgcggcacaaatggac
ggcgctatcttagtagtagcagcaacagatggtcctatgccacaaactcgtgagcacatt
cttttaggtcgtcaagtaggtgttccttacatcatcgtattcttaaacaaatgcgatatg
gttgatgatgaagaattattagaattagttgaaatggaagtacgtgaacttctatctcaa
tacgatttcccaggtgatgacacaccagtaattcgtggttcagcgcttaaagcgttagaa
ggcgatgcagaatgggaagaaaaaattgttgaattagcaaatgcattagacacctacatt
ccagaaccagagcgtgacattgataaaccattcttattaccaatcgaagacgtattctca
atctcaggtcgtggtacagtagtaacaggtcgtgtagagcgcggtgtaatcaaaactggt
gaagaagttgaaatcgttggtatcaaaccgactactaaaacaacttgtactggtgtagaa
atgttccgtaaaatactagacgaaggccgcgcaggtgaaaacgttggtatactattacgt
ggtacaaaacgtgaagaaatcgaacgtggtcaagtactagcaaaaccaggttcaatcact
ccacatactgattttgaatcagaagtgtatatcctaagcaaagatgaaggtggtcgtcat
actccattcttcaaaggctaccgtccacagttctacttccgtacaactgacgtaactggt
actatcgaattaccagaaggcgtagagatggtaatgccaggtgataacatcaaaatgaca
gtatcattaattcacccaatcgcgatggcagacggcttacgtttcgctatccgtgaaggt
ggtcgtactgttggtgctggtgttgttgctaaggttattaaataa

DBGET integrated database retrieval system