KEGG   Gemmatirosa kalamazoonesis: J421_0092Help
Entry
J421_0092         CDS       T03025                                 

Definition
(GenBank) peptidase M2 peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
gba  Gemmatirosa kalamazoonesis
Brite
Enzymes [BR:gba01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     J421_0092
Peptidases [BR:gba01002]
 Metallo Peptidases
  Family M2
   J421_0092
Exosome [BR:gba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J421_0092
CD molecules [BR:gba04090]
 Proteins
  J421_0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
67862..69766
Genome map
AA seq 634 aa AA seqDB search
MTRYLPLAALALATVLATVARAQQPVTKDAPAVAAARSIGTTPTAAAARLFVDSVERRLD
ALSVTVNQAEWVAATYITDDTEALSADAQQRYDAAAQRFALAARRFDGVTVPPDLRRKLT
LLKLAFTAPPPSDPAKGAELVRLTTGMEGAYGRGTYCRRGALGQPAATTGDSTCYQINDL
SRALAESHDPAVLLDAWRGWHAIGAPLRPKYERFVALSNEGARELGFADLGAMWRANYDM
PADQFPREVERLWKQVEPLYVALHAYVRTRLNQQYGDAVVAKDGMIPAHLLGNMWAQEWG
NVYPIVAPPNASPTYDLTALLKAKNVDAKGMAKYAEGFFTSMGFAPLPATFWERSMLVKP
RDREVVCHASAWTIDNKNDVRIKACLEPTADDFVTIHHEEGHNFYQRAYSSQPYLFQNGA
NDGFHEAIGDAIALSITPGYLQQAGLLATPPSAAADTALLLRQALDKVAFLPFGLMIDQW
RWGVFSGAIKPSEYNKAWWDLRARYQGVVPPVARSEADFDPGAKYHVPANTPYMRYFLAR
VLQFQFYRAMCRAAGHTGPLYRCSFYGSKEAGAKLARMLEAGQSKPWQETLYEMTGERDM
DAGAMLEYFAPLKAWLDRQNAGHPVGWTPRTATR
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgttacctccctctcgccgcgctcgccctcgcgaccgtgctcgcgaccgtggca
cgcgcgcaacagcccgtgacgaaggacgcgcccgcggtcgccgccgcgcgctccatcggc
accacgccgaccgccgccgcggcgcgcctgttcgtcgactccgtcgagcgccggctcgat
gcgctgagcgtgaccgtgaaccaggccgagtgggtcgccgcgacgtacatcaccgacgat
accgaggcgctctccgccgacgcgcagcagcgatacgacgccgccgcgcagcgcttcgcg
ctcgccgcgcgccgcttcgacggcgtgaccgtcccacccgatctgcggcgcaagctcacg
ctgctgaagctcgcgttcacggcgccgccgccgagcgacccggcgaagggcgcggagctc
gtgcgcctcacgaccggcatggagggcgcgtacggccgcggcacgtactgccgtcgcgga
gcgctcggccagcccgcggccaccaccggcgactccacctgctatcagatcaacgatctg
tcgcgcgcgctcgccgagagccacgaccccgcggtgctgctcgacgcgtggcgcggatgg
cacgcgatcggcgcgccgctgcgcccgaagtacgagcgcttcgtcgcgctgtcgaacgag
ggtgcacgcgagctcgggttcgcggacctcggcgcgatgtggcgcgcgaactacgacatg
cccgccgaccagttcccgcgcgaggtcgagcggttgtggaagcaggtggagccgctgtac
gtggcgctgcacgcctacgtgcgcacgcggctcaaccagcagtacggcgacgccgtcgtc
gcgaaggacgggatgatcccggcccatctgctcggcaacatgtgggcgcaggagtggggc
aacgtctacccgatcgtcgcgccgccgaacgcgtcgcccacgtacgacctcacggcgctc
ttgaaggcgaagaacgtcgacgcgaaagggatggcgaagtacgcggagggcttcttcacg
tcgatggggttcgcgccgctgccggcgacgttctgggagcggtcgatgctcgtgaagccg
cgcgatcgcgaggtggtgtgccacgcgagcgcgtggacgatcgacaacaagaacgacgtc
cgcatcaaggcgtgcctcgagccgaccgccgacgacttcgtcacgatccaccacgaggag
gggcacaacttctaccagcgcgcgtactcgtcgcagccgtacctgttccagaacggcgcg
aacgacggcttccacgaggccatcggcgacgcgatcgcgctgtcgatcacgccgggctac
ctgcagcaggccggtctgctcgcgacgccgccgagcgcagcggccgacaccgcgctgctg
ctgcgccaggcgctcgacaaggtcgcgttcctcccgttcggcctcatgatcgaccagtgg
cggtggggcgtgttcagcggcgcgatcaagccgtcggagtacaacaaggcgtggtgggac
ctgcgcgcgcgctaccagggcgtcgtgccgccggtggcgcgcagcgaggcggacttcgac
cccggcgcgaagtaccacgtcccggcgaacacgccgtacatgcgctacttcctcgcccgc
gtgctgcagttccagttctatcgcgcgatgtgccgcgcggccggccacaccgggccgctg
tatcggtgctcgttctacggcagcaaggaggcgggggcgaagctggcgcgcatgctggag
gcgggccagagcaagccgtggcaggagacgctgtacgagatgacgggcgagcgcgacatg
gacgccggcgcgatgctggagtacttcgcgccgctgaaggcgtggctcgaccggcagaac
gccgggcatcccgtcggctggacgccgcgcaccgcgactcgatga

DBGET integrated database retrieval system