KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1334Help
Entry
GbCGDNIH1_1334    CDS       T00392                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GbCGDNIH1_1334
  Energy metabolism
   00680 Methane metabolism
    GbCGDNIH1_1334
Enzymes [BR:gbe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GbCGDNIH1_1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1486680..1489493)
Genome map
AA seq 937 aa AA seqDB search
MHKIPVMADMHDTQAPADLAAELLSVTERSVERSTEDPFGNPMLSVALAIARRIESGSLS
HASLVALVKHLRDAAYLDRARRLANYVGGIEGADEALAHVARRVVRPDPNDSPISFRDFQ
PEVERTRFAAVFTAHPTFSMPAEVGHALAEAAGGAEVSSFESHRPPSVTLEDEFDQAVAA
IINGRDAIDQLNRNLLVAARDVWPDRWSDLTPRPVILTSWVGYDTDGRTDIGWWDTLRLR
LRMKRLQLERVLAQLASLAGTDALQRTVTQAIEAVSNQIESCPTTQDPDGVQAFAQALIT
RRQEAITDPAALLPQFDAVISTADEETRLALCVIRAGLVSHSMSLAHTHVRLNATQLHNV
ARQRLGITDPPEDQSRRRILLSKINEALDTVQPVNIDFGTLIAEQASAARLMMTVAQVVK
HIDSAAPVRFLIAETESGYTLLTALWLARLLGIEDRIEISPLFETADALEQGARILQEAL
RSPHYRAYLQKTGRLALQFGYSDSGRYVGQLAASYLIERLRMKIAELLARYDVKGVEVIL
FDTHGESIGRGAHPGSLYDRLKYLSPTKSRKALRAAGVVVREESAFQGGDGYLLFGTPAL
ATATIARIAEHAFPRMSGPKDPVYDEQDFASDYFTTIRTHMEELVEDPGYAALLGAFGPA
LIDKTGSRPAARQSDGAVGRPQISHPRELRAIPNNAILQQLGWCANSIHGIGAALIRHPE
TFDDLYQNSFRFRRAMNLAEHALRHSDLDVLRAVVATFDPTTWLDRAAHERETDQRKTKA
LMLVAKAVERLGLAAVTQAMFRRIQVDHLQLRAGWSDAPRMTMRERLLHALRLALIHRIW
LLETEIPDFSPRHGVTRQALEALILRLEIPLALNLLSQVFPPAPDPAVERDYFEPSTERQ
GSSYAHEHATIFQPMSDMFDLVREIGTAISHEVGAFG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
gtgcacaaaattccggtgatggcagacatgcacgacacgcaggcacctgcggacctggcc
gccgaattgctttcggtcacagaacgctctgttgagcgctctaccgaagatcccttcggc
aatccgatgctttcagtggcgcttgcgattgcgcgccgaatcgaaagcggatcattaagt
cacgcctctctcgtggcgctggtaaagcatctgagagatgccgcctatctcgaccgcgca
cgaaggcttgccaattatgttggtggcatcgaaggggctgacgaggcgctcgctcacgtg
gcccggcgtgtggtcaggcctgatcccaatgacagcccgatttctttccgcgattttcag
cctgaggttgagcgaacccgctttgccgccgtctttacggctcatccgacgttctcaatg
ccagctgaggttggtcacgcgctggcagaagcagccggtggcgctgaagtatcttctttc
gaatcgcatcgtcccccttctgtaactctggaagacgagttcgatcaggcagtggctgcc
attatcaatggccgtgatgccatcgatcagttgaaccgcaacctgctggtggccgcccgt
gatgtctggccggatcgctggagcgatctgacgccaaggccggttattctgaccagctgg
gttggctacgatacggatggtcgtaccgatattggctggtgggacacgttacgcctgcgg
ctgcgtatgaagcgcctccaactggagcgcgttctggcacaattggcctcgctcgcggga
accgatgcgcttcagcggacagtgactcaggcgattgaggccgtttcgaaccagatcgaa
tcttgcccgacgacacaggatcccgatggcgtgcaggcttttgctcaggcgctcatcaca
cgtcggcaggaagcgatcactgatcctgctgccctgctgccgcaattcgatgcggtgatc
agcacggcagatgaggagacgagactggcactgtgcgtgatccgtgcaggcctggtgtcg
cattccatgtctctggctcatacgcatgtgcgtctgaatgcgacccagctgcataatgtt
gcccggcagcgtctgggcattacagatccgccggaagatcagtcccgccgtcgtattctg
ctgagcaagatcaacgaggcgctcgatactgttcagcccgttaatatcgattttggtacg
ctgattgccgagcaggcttcggcggcccggttgatgatgacggtggcgcaggttgtcaaa
cacatcgacagtgcagcaccagtcagattcctgatcgccgagaccgaaagcggttacacg
ctgttgactgcgctgtggctggcaaggcttctggggatcgaggaccggatcgagatttct
ccgctgttcgagaccgccgatgcgttggaacagggcgctcgaatcctgcaggaagcgctg
cgcagcccgcattaccgcgcctatctgcaaaagaccggtcgtcttgcacttcagttcggt
tattcggattccggtcgttatgtcggacagctggccgccagctatctgatcgaacgcctg
cgtatgaaaattgccgagctgctggcccgttatgacgttaagggtgtcgaggtcattctg
ttcgatacgcatggcgaaagcatcggacgtggtgcgcatcccggctcgctctatgatcgc
ctgaaatatctttcgcccaccaaaagccgcaaggcccttcgtgctgcaggcgttgtggtg
cgtgaggaaagtgcttttcaaggcggtgatggctatctgttgttcggcactccggcgctg
gcaacggccacgattgcccggattgcggaacatgctttcccacgtatgtcaggcccgaaa
gatcccgtttatgatgagcaggattttgcctcggattacttcacgaccatccgtacgcat
atggaagagctggtggaagatccgggctatgccgctctgttgggtgcgttcggcccggct
ctgatcgacaagaccggctcccgcccggccgcccgccagagcgatggagccgtggggcgt
ccgcagattagccatccgcgcgaattgcgggccatccccaataacgccatccttcagcag
ttgggctggtgtgccaattccattcacggcattggcgcggccttgatccgtcatcctgaa
acgttcgacgatctttatcagaacagcttccgtttccgccgggccatgaatctggccgag
catgcgttgcgccattctgatctggacgtattgcgtgccgtggtggcgacattcgacccc
accacctggctggatcgtgcagcgcatgagcgagaaaccgatcagcggaagacaaaggcg
ctgatgctggtagccaaggcggtggagcggctggggctggcggcggtgacacaggcgatg
ttccggcgcattcaggtggatcacctgcaactgcgtgctggctggtctgatgcaccgcgc
atgaccatgcgtgagcgcctgctgcatgcgctgaggctggcgttgattcatcgtatctgg
cttctggagacggaaattcctgatttctcgcctcgtcatggagtaacccgtcaggctctg
gaagccctgattttgcggctggaaattcctctcgccctcaatcttctgagtcaggtattc
ccgcctgcgccagacccggcggtggaacgggattatttcgaaccatcaactgaacgccag
ggcagcagctatgctcatgagcatgccactattttccagccgatgagcgatatgtttgat
ctggtgcgggagatcggcacggccattagccatgaggtgggcgcttttggataa

DBGET integrated database retrieval system