KEGG   Granulibacter bethesdensis CGDNIH2: GbCGDNIH2_0054Help
Entry
GbCGDNIH2_0054    CDS       T03083                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gbh  Granulibacter bethesdensis CGDNIH2
Pathway
gbh00620  Pyruvate metabolism
gbh00680  Methane metabolism
gbh01100  Metabolic pathways
gbh01120  Microbial metabolism in diverse environments
gbh01200  Carbon metabolism
Module
gbh_M00168  CAM (Crassulacean acid metabolism), dark
gbh_M00346  Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:gbh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GbCGDNIH2_0054
  Energy metabolism
   00680 Methane metabolism
    GbCGDNIH2_0054
Enzymes [BR:gbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GbCGDNIH2_0054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHJ67036
LinkDB All DBs
Position
57334..60114
Genome map
AA seq 926 aa AA seqDB search
MTNMQRSDIMTGTSRPDVSAAGRGTACLLRDLLLEVAARHHPDIVPALTGEGRWSLSTMT
PQALGRALQAQGIWFQLLSIAEQKEAMRQRRAVEKQGSRADVRGTFDAVLAEAKAAGISA
DTLSDTLAGLRIRPVVTAHPTEAKRVTVLEKHREIYLLLLELDNPRWTEREHARLVRRLR
DQIELLWLTGELRLEKVSVQQEVHWGLHFFRESLFEIVPQVAASLEEAVAAQYPDAPAPS
PRRDAGGFLQFGSWVGGDRDGNPYVTNDVTRWTLRENAQASLEHYRKQIARLIKSLSVTE
HALTIPQWFLALVRERVEAMTDAPSLAQRNPGEPFRQFLTVMDVRLEDTLRLQTGGDADF
GATSHAYPSADALIDDLRAMEKALEDAGSPEIAADLIRPLRCSAEIFRFSTVRLDLRQNS
TRLTNALHAYWRDVTGQGLQSEPPSDDSAEWEEFLLDALQQPRLARLTPQDWPEDAREVL
EMFQLVAEMRGRLDREAFGSFILSMTRSVADILGAYVMAKQAGLFLDSVGMELCELPIVP
LFETIDDLRAAPLIMRRLLNIPVIRRSARRQGNVQEVMIGYSDSNKDGGFISANWELFRA
QSRLAQVGQDAGIAIAFFHGRGGSVSRGGAPTRRAIAAQPPGSIRGRFRVTEQGEVVSAK
YANKGTASYQAELLAASVLDHALRSERLADSIASVRPEYEDAMEALSGAANAAYRSLIGN
PHMVGYFQSASPLEEFALLNIGSRPARRFGARSLSDLRAIPFVFAWTQNRHLITSWYGVG
SAISTFLDVRGERGEEVLRRMFADYPLFRLIADEVEKALLFVDLEIARLYAGLVPEEEAR
QAILPLVEAEYQLTCAMITRISGDAQVGERFHRYRTRLTERLPVINAANREQVELLRRFR
DAPDDAVKSALLLSINCIAGGFGTTG
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacatgcagcggtctgacatcatgacaggcacttcccggccggatgtttcggca
gccggccggggaacggcttgtcttctgcgagatctgctgctggaagtggcggcacgtcat
catcccgatatcgtgccggctttgacgggggaggggcgctggtccctctccaccatgaca
ccgcaggcgctcggcagggcgttgcaggcgcagggcatctggtttcagcttctgtcgatt
gccgagcagaaagaagccatgcgtcagcgccgggcggtggaaaaacagggcagccgcgcc
gatgtgcgcggtaccttcgatgccgtgctggcggaagcgaaagccgctggtatttcggct
gatactctgtccgatacgctggccggtttgcgcatccggccggtggtaaccgcacacccg
accgaggccaagcgtgtgacggtgctggaaaagcaccgcgagatttatctgctgttgctg
gaactcgacaacccgcgctggaccgagcgggagcatgcgcgtctggtacgccgtctgcgc
gatcagatcgaattgctctggctgaccggtgagctgcgactggagaaggtctccgtgcag
caggaggtccattggggtctccattttttccgcgaaagcctgttcgagatcgtgccgcag
gtggcggcatcgctcgaagaagccgtggctgcgcaatatccggatgctcctgccccctct
ccgcgtcgcgatgcgggaggcttccttcaattcggttcctgggttggcggcgatcgcgat
ggcaatccttatgtgacgaatgacgtcacgcgttggaccctgcgggaaaatgcgcaggcc
agtctggagcattatcgcaaacagattgcccgcctcatcaaatccctgtcggtgaccgaa
catgcgctgaccattccgcaatggttcctggcgctggtgcgggagcgggtggaggcgatg
acggatgctccctctctggcgcagcgtaatccgggcgagccgtttcgtcagttcctgacc
gtgatggatgtgcggcttgaagacacattgcgtcttcagacggggggcgatgcggacttt
ggcgccacgtctcatgcctatcccagcgctgatgcgctgatcgacgatctccgcgccatg
gaaaaggcgctggaagacgcaggcagccccgaaatcgccgccgatctgatccggccgtta
cggtgcagtgccgagatcttccgtttcagtacggtacggctggatctgcggcagaactcc
acgcgcctgaccaatgcgttgcatgcctattggcgcgacgtgaccgggcagggactacaa
agcgagccgccctcagatgacagtgctgaatgggaagaattcctgctggatgctcttcag
caaccccgcctggcccgcctgaccccgcaggactggccggaagatgcgcgcgaggtgctg
gagatgtttcagctggtcgccgaaatgcgtggcaggctggatcgggaggcattcggcagc
tttattctgtccatgacccgttcggtggccgatattctcggtgcctatgtgatggcgaaa
caggctggcctgttcctcgattccgtcggtatggagctgtgtgaactgccgatcgtgccg
ctgttcgagacgatcgacgatctgcgtgccgcaccgctgatcatgcgccgcctgctgaat
attccggtgatccggcgctcggcccgtcggcagggcaatgtgcaggaagtcatgatcggc
tactctgacagtaacaaggatggtggtttcatctccgccaactgggagctgttccgtgcg
caatcccgtctggcacaggtcgggcaggatgcgggcattgccatcgcgttcttccatggc
cgtggcggcagcgtcagccgtggtggcgcaccgacccgtcgggctattgccgcccagccg
cccggctctatccgcggacgtttccgcgtgacggaacagggtgaggtggtcagcgccaaa
tatgccaataagggcacggcttcctatcaggcggaactgctggcggcgagtgtgctggat
catgctttgcgcagtgaaagactggctgattccattgcctctgtccgtcctgaatatgaa
gatgcgatggaggctctgtcaggggctgccaatgcggcctatcgcagtctgatcggcaat
ccgcacatggtcgggtatttccagtcggccagcccgctggaagaattcgccttgctgaat
atcggcagtcgtccagcgcgtcgtttcggtgcgcgttcgctgtccgatctgcgggccatt
ccttttgtgttcgcctggacgcagaaccgccatctgatcaccagctggtatggtgtgggc
agcgccatctccactttccttgatgtgcggggtgagcgcggcgaagaggtgctgcgtcgc
atgtttgcggattatccgctgttccgcctgattgcggatgaggtggaaaaggcactgttg
ttcgtcgaccttgagattgcccgtctctatgccggtctggtgccggaagaggaggcgagg
caggccatcctgccattggtcgaggctgaatatcagctgacctgcgccatgatcacccgg
atcagcggggatgcgcaggtgggcgagcggttccaccgttatcgcacccgcctgaccgag
cgcctgccggtgatcaatgctgccaatcgggaacaggtggagctgctgcggcgcttccgg
gatgccccggatgacgcggtgaaatcggccctgctgctatctatcaattgtattgctggc
ggcttcggtaccacgggctga

DBGET integrated database retrieval system