KEGG   Geobacter bemidjiensis: Gbem_2204Help
Entry
Gbem_2204         CDS       T00749                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, iron/manganese-containing
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gbm  Geobacter bemidjiensis
Brite
Enzymes [BR:gbm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Gbem_2204 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2564278..2564862
Genome map
AA seq 194 aa AA seqDB search
MTAFTAKDYSRLIGMPGFSETLLNNHFTLYQGYVKNTNTLDDALTELRKSGKGSDPGFAE
LKRRFGWEFNGMRLHEYYFENLGGNQPINQDGRLASRIHQDFGGFDEWVQDFKSVGAMRG
IGWAIMYQDLSNGRLLNFWINEHDAGHPAGCTPVLIMDVFEHAFMTDYGLKRADYINAFF
QNIDWNSAEQRLQM
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgttcacggcaaaggactactcgaggctgatagggatgcctgggttcagcgag
acactcctcaacaaccatttcaccctttaccaggggtacgtaaagaacaccaacaccctc
gacgacgccctgacggagctgcgcaagtccggcaaggggagcgaccccggcttcgccgag
ctcaagcgccgcttcggctgggagttcaacggcatgaggctgcacgagtactacttcgag
aacctgggcgggaatcagccgataaaccaggacgggaggctcgcctccaggatccaccag
gatttcggcgggttcgacgagtgggtacaggacttcaagtcggtcggggccatgcgcggc
ataggctgggccatcatgtaccaggacctcagcaacggcaggctgctcaacttctggatc
aacgagcatgacgccggccatcctgccgggtgcaccccggtcctgatcatggacgtcttc
gaacatgccttcatgaccgattacggcctgaagcgcgccgactacatcaacgctttcttt
cagaacatcgactggaacagcgcggagcagcggttgcagatgtga

DBGET integrated database retrieval system