KEGG   Granulibacter bethesdensis CGDNIH4: GbCGDNIH4_0751Help
Entry
GbCGDNIH4_0751    CDS       T03156                                 

Definition
(GenBank) Trehalose synthase
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
gbs  Granulibacter bethesdensis CGDNIH4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GbCGDNIH4_0751
Enzymes [BR:gbs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GbCGDNIH4_0751
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     GbCGDNIH4_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2570831..2574337
Genome map
AA seq 1168 aa AA seqDB search
MISSGPERSSISGLIHGRAPMPSGAPDPPSDNTADGKSDQIFPCALTGLKTKLIGVHMSK
NTALSPIEDPLWYKDAIIYQLHVKSFFDGDNDGIGDFKGLLSKLDYIAELGVTAIWLLPF
YPSPRRDDGYDIADYRGVHKDYGSLADFRRFVAEAHARGLRVITELVVNHTSDQHPWFKK
ARESKPGSAARNFYVWSDDDKKYSGTRIIFLDTEKSNWTWDETAKAYFWHRFYSHQPDLN
FDNPRVLQEVLSVMRFWLDIGVDGLRLDAVPYLVEREGTNNENLPETHDILKRIRAELDA
HAPGRMLLAEANQWPEDAQQYFGEGDECHMSFHFPLMPRMYMAIAREDRFPVTDIMRQTP
EIPALCQWAVFLRNHDELTLEMVTDSERDYLWSTYAADRRARINLGIRRRLAPLLEHDRR
RIELMNGLLLSMPGTPVIYYGDEIGMGDNIHLGDRDGVRTPMQWSSDRNGGFSRANPAAL
VLPTIMDPVYGFQAVNVEAQAADQHSLLNWMRRMLAVRRQFTAFGRGTLRFLYPENRKVL
AYLREHEDSGNEQTILCICNLSRSAQAVELDISAFSGRVPVDMVGGSAFPPVGQLPYLLT
LPPYGFFWFVLAQSEHLPHWYTPPSESLPDYATVVIRSDISEVLEAQNRKILETESLPAY
LPKRRWFGAKGERVKAARFAYMARLGGHEGDPVLLGEVEVQLGSFTERYTLPLGIVWEDD
ISSPLVAQLALARVRRGRRVGYLTDAFAVDSLTGALMTSLRRAANNHSSLSVDDGTIEFR
PTPLLAEVTLPPEPEIRRLSAEQSNSSLILGETIVFKLIRRVSSGIHPEGEMTRVLTERG
FANTAPLYGEMVRIGPDGTPHTLALAQGFVRNQGDAWQWTLDFLSRAVEEYAVTGRNGTT
ESDLFGGYNVLASAIGRRLAEMHAILTWPDDNPDFSPVAVDVHDLQGWADSAREQLRDAF
RLLHGMTEFASNETADQVRALLAQEAEIVERLDTLATKGAGAIKTRIHGDFHLGQVLVVQ
DDAYLIDFEGEPARPLEQRRAKGNGLRDVAGLLRSFDYAASSGGMSLTIAGAAQMTERRD
HLLQQFRQSATRSFLDAYLEVLRSADTPWVQPEGIEPLLTLFLIEKAAYEIRYEAANRPG
WIGIPVAGLYHLVFGASPSSPATDEGHS
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgatttcatctggaccggaaagatccagcatatccggcttgatccatggacgcgcccct
atgccatctggcgcgccagatccgccatctgacaacactgccgacgggaagtctgaccaa
atttttccttgtgctttgactggcctgaagaccaagttgattggagttcacatgagcaaa
aacaccgcactgtcacccattgaagatccactctggtacaaagatgcaatcatctaccag
ttgcacgtcaaatcattcttcgatggcgacaatgacggaattggtgactttaaaggactt
ctttcaaaactcgactatattgccgagctcggggtcacggccatatggctgctgcctttc
tatccttctccccggcgcgatgacggatatgatattgccgattacaggggggtccataaa
gattacggatcactggccgatttccgccgctttgtagccgaagcccatgcgcgcgggctg
agggtgattacggagctggtggtcaatcatacgtccgaccaacacccatggttcaaaaaa
gcccgggaaagtaagcccggatcggcagcacgcaatttttatgtctggtccgatgacgac
aaaaaatatagcggcaccagaattatctttctcgacacagagaaatccaactggacatgg
gatgaaacggccaaagcctatttctggcaccgcttctactcccatcagcctgatctgaat
ttcgataatcctcgcgtcttgcaggaagttctgtcggtgatgcggttctggctggatatc
ggcgttgatggattgcgccttgatgccgtgccttatctggtggagcgagagggcaccaat
aatgaaaaccttcctgaaacgcacgatattctgaaacgcattcgcgctgaactcgatgcg
catgcaccgggcagaatgctgctggcagaagccaatcaatggccggaagacgcgcagcaa
tatttcggcgagggcgatgaatgccatatgtcgtttcattttccgctgatgccccgcatg
tatatggccattgcacgggaggatcgcttcccggtcaccgacatcatgcggcagacacct
gaaattccagccctctgtcagtgggcggtgtttctgcgcaaccatgatgagctgacgctg
gaaatggtcaccgatagcgaacgagactatctatggagcacgtacgctgctgatcgaagg
gcacgcatcaatctgggcattcgccgccgtctggcaccgctgctggaacatgaccgccgc
cgtatcgaattgatgaacgggctgctgctctccatgccgggaacgccggttatttattac
ggcgatgaaatcggtatgggcgacaatatccatctcggcgaccgtgatggggtgcgcacg
ccgatgcaatggtccagcgaccgcaatggcggtttttcccgtgctaatccggcagcactg
gttctgccgacgatcatggacccagtctatggatttcaggccgtcaatgtggaagcgcag
gcagcggaccagcattccctgctgaactggatgcgccgcatgttggcggtacgcaggcag
ttcacggctttcgggcgcggcacgctgcgtttcctgtatccggagaaccgtaaagttctg
gcctatctgcgtgaacatgaggatagcggcaatgagcagaccattctctgtatctgcaat
ctgtcccgctcggcgcaggcagtcgagctggacatcagcgccttcagtggacgcgtcccg
gtggacatggtcggtggctctgcttttccccccgttgggcaattgccgtatctgttgacg
ctacccccttatggtttcttctggttcgtgctggcccagagcgagcatctgccacattgg
tacacgcccccatccgaatctctgccggattatgcaacggtggtgatccgttccgacatc
agcgaggttctggaagcacagaaccgcaaaattctggaaactgaaagcctccccgcctat
ctgccaaaacggcgctggttcggcgcgaaaggcgaaagggttaaagccgcacgctttgcc
tacatggcccgtctcggcggccatgagggtgatccggtgctgctgggtgaggttgaagtt
cagctcggctcatttaccgaacgttatacgcttccactcggtattgtgtgggaggatgat
atcagcagcccgctggtcgcacagcttgccctggcccgtgtacgacgtggacgaagggtg
ggctatcttaccgatgcctttgcggtggacagcctgacgggcgcactgatgacaagcctg
cgccgtgctgccaataatcacagctcattgagcgtggatgatggcacaatagaatttcgc
ccgaccccccttctggcggaggttacgctgccaccagagccggaaatccgacgcctgtca
gccgaacagtcgaattcttcgctgattttgggagaaacgatcgtattcaagctgatccgt
cgtgtcagcagcggtatccatcccgagggcgagatgacgcgggtgctgactgaacgcggt
tttgcgaatacagcaccgctttatggcgagatggtgcggatcggccccgatggcacaccg
catacgctggcgctggcacagggcttcgtgcgcaaccagggtgatgcgtggcaatggacg
ctggacttcctcagccgggcggtggaggaatatgccgtcaccggtcgcaatggcacaacg
gaaagtgacctgttcggcggttataatgtgctggcctccgctatcggccgtcgtcttgcg
gaaatgcatgcgatcctgacatggcccgatgacaatcctgatttcagccctgttgccgtc
gatgtccatgacttgcaaggctgggccgacagtgcgcgggaacagttgcgcgacgccttc
cgcctgctgcatggcatgacggagtttgcttccaacgaaactgccgatcaggtcagagct
ctgctggctcaggaggcggaaatagtggaacgcctcgatacactcgccacaaagggagca
ggcgcaataaagacccggattcacggggatttccatcttggacaagtgctggtcgtgcag
gatgacgcctacctgatcgatttcgagggcgagcctgcccgtccgctggagcagcgacgc
gccaaaggcaatggtttgcgagacgttgcgggtttgctgcgcagttttgactatgcggcc
tcctccggcggcatgtcgctgaccattgccggcgctgcacagatgacggaacgacgggat
catttgttgcaacagttccggcagagtgccacacgcagtttccttgatgcctatctggag
gttttgcgttcagcagatacgccctgggttcagccggaagggatcgagccactgctgacg
ctgttcctgattgaaaaagctgcctacgaaatacgctacgaagccgccaaccggccgggc
tggatcggcattccagtggcggggctgtaccatctggttttcggtgcatccccctcttct
ccggctaccgatgaaggacattcctga

DBGET integrated database retrieval system