KEGG   Gallionella capsiferriformans: Galf_2512Help
Entry
Galf_2512         CDS       T01295                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gca  Gallionella capsiferriformans
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Galf_2512
  Energy metabolism
   00680 Methane metabolism
    Galf_2512
Enzymes [BR:gca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Galf_2512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2703897..2706665
Genome map
AA seq 922 aa AA seqDB search
MNLFSAPADISSKDLPFREDVRLLGRILGDTLREQEGEATFQLVENVRRSAVRFRKTQDE
RDGEQLEQMLDALSPSETLAVVRAFSYFSQLTNIAEDLHHNRRHRAHLKAGSSPKNGSLM
LALDRIEEKQVSPEAMQAFLDSALISPVLTAHPTEVQRKSILDCHLIISSLLSNRDRIEM
TPDELAENENALRRFVLILWQTRMLRTAKLTVRDEIRNGLEFYRYTFLTEIPKLYANLEK
QLEARFDKDIKIPALLKVGSWIGGDRDGNPFVTHDVMQYAVQQHSELAFEHYLNETHILG
TRLSLTDRLVDVSDELRAMSDASPDNAVSRTDEPYRRALIMIYSRLSATAGKLGHEISHL
PPVDKAAAPYATPAQFIADLDVLIESLNRHGAIYLARGRLANLRRSAEIFGFHLAPLDMR
QHSAIHEQTVSELLAHSGVMANYSELDEAARREILLTTLQAAKPLMGKIDQYSDIAQSEL
RIMQAAADIHQRFGRAALPNHIISKADAVSDMLELALMLQQVNLLEGRDALHINIIPLFE
TIEDLRSCGPIMDELFAIPYYRQLLACRGNTQEVMLGYSDSNKDGGYITANWELYKAELE
LVKVFAKYGVELRLFHGRGGTVGRGGGPSYEAILAQPPGSVNGQIRITEQGEVISSKYSN
PEIGQRNLETLVAATMEATLLHHHGADSAMPEFHRIMEALSLDAFAAYRKLVYETPGFTE
YFFTATPIREIAELNIGSRPSARRASDRIEDLRAIPWVFSWGLNRTLLPGWLGFGSAVKQ
FIAREGDDGLAQLQTMYREWPFFRGLMSNMDMVLSKTDMGIASRYAALVEDVEMRERIFG
AIHSEWQDTVELLFSVTRNDALLQENPSFARSLLSRTPYIDPLNHLQVALLEHHRAGNTD
ELVKRAIHLTINGIATGLRNSG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgaacttattttctgcccctgccgacatttccagtaaagacctgcccttccgcgaagac
gtgcgcctgctaggccgtatcttaggcgatacgctgcgcgaacaggagggtgaagcgacc
ttccagctggtcgaaaacgtgcgccgctcagcggtacgctttcgcaagactcaggacgaa
cgcgatggagaacagctcgagcagatgctcgatgcattaagccccagcgaaacgctggcc
gtggtgcgcgccttcagctacttctcgcaactgaccaatatcgccgaggatttgcaccac
aaccgccgccatcgcgcccatctgaaagccggttcatcgcctaaaaacggcagcctgatg
ctcgcgctcgaccgtatcgaagaaaaacaggtcagccctgaagcgatgcaagcctttctg
gacagcgcactgatctctccggtactgaccgcgcatccgaccgaagtacagcgcaaaagc
atactggactgccatctgatcatctccagcctgctatccaaccgcgaccggatagagatg
acgccggacgagctggcagaaaacgaaaatgcgctgcgtcgcttcgtgctgattctgtgg
cagacgcgcatgctgcgcaccgcaaaattgacggtgcgcgacgaaattcgcaacggtctg
gagttctaccgttacaccttcctgactgaaattccaaagctgtatgcgaatctggaaaag
cagctggaggcgcgcttcgacaaggacatcaagattcccgcactgctcaaggtcggcagc
tggataggcggcgaccgcgacggcaatcctttcgtcacccacgatgtgatgcagtatgcg
gtgcaacagcactccgaactcgcattcgaacactacctcaatgagacgcatattttgggc
acgcgcctgtcgctgaccgatcgcctagtcgatgtcagtgacgaattgcgcgcgatgtcc
gatgcctcccccgacaatgcggtgagccgcacagatgaaccgtaccgccgcgcgctgatc
atgatttattcgcgcctgtcggctacagcaggaaaactgggacacgaaatatcgcatctt
ccgccggtcgataaagcggcagcgccttacgcgacaccggcgcagttcatcgccgatctg
gatgttttgattgaatcactcaatcgtcatggcgcgatctatctggcgcgcggccgcctg
gccaacttgcgccgctcagcagaaatcttcggctttcatctggcgccgctggatatgcgg
cagcacagcgccatccacgaacaaaccgtcagcgaattgctggctcacagcggtgtcatg
gcgaactacagcgaactcgatgaagctgcgcgccgcgaaattctgctcaccaccttgcag
gctgcgaagccgctgatgggtaaaatcgatcaatattccgatatcgcacagagcgaattg
cgcatcatgcaggccgcagccgacattcatcagcgctttggccgcgccgctctgcccaat
cacatcatctcgaaagcggatgcagtgagcgatatgctggaactggcactgatgctgcag
caggtcaatctgctcgaagggcgtgacgcgctgcatatcaacatcattcctctgttcgaa
accatcgaagatctgcgcagctgcggacctatcatggacgaactgttcgccattccctat
taccgccaactgctggcctgccggggaaatacgcaggaagtcatgctgggctattcggac
agcaacaaggatggcggttacatcaccgcgaactgggaactgtacaaagccgaactagaa
ctggtcaaagtgttcgctaaatacggcgttgaactgcgcctgttccatggtcgtggcggc
accgtcggtcgcggcggtggcccaagctatgaagcgattctggcgcagccacccggcagc
gtaaacgggcagattcgcatcaccgaacagggtgaagtgatttccagcaaatactccaac
cctgaaatcggtcagcgcaatctggaaacgctggtggctgccaccatggaagcgaccttg
ctgcatcatcacggcgcggacagtgcaatgccggaatttcaccgcatcatggaggccttg
agcctcgatgcctttgctgcctaccgcaagctggtttatgagacacccggatttaccgag
tattttttcaccgccacgccgatacgcgaaattgcagaacttaacatcggcagccgccct
tccgcacgccgcgcctccgatcgcatcgaagatctgcgcgcgatcccctgggtattcagc
tggggattaaaccgcacgctgctaccgggctggctgggattcggcagcgcagtcaagcaa
tttatcgcacgcgaaggcgacgatggcctagcacaattgcagacaatgtaccgggaatgg
ccgtttttccgcggcctgatgtcgaacatggatatggttctgtccaagaccgatatgggc
attgcatcgcgctacgcggcgctggttgaagatgtagaaatgcgtgaacggatcttcggc
gctatccacagcgagtggcaggacaccgtcgaattgctgttttccgtgacacgcaacgat
gcactgttgcaggaaaatccgtcatttgcacgcagcctgctcagccgcacaccgtatatc
gatccgctcaaccacttgcaagtcgccttgctggaacatcaccgggccggcaacaccgac
gaactggtcaaacgggcgatccacctgaccatcaacggcatcgcaaccggcttgcgcaac
agcggttaa

DBGET integrated database retrieval system