KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI0710Help
Entry
GDI0710           CDS       T00631                                 

Gene name
dadB
Definition
(GenBank) putative alanine racemase, catabolic
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    GDI0710 (dadB)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    GDI0710 (dadB)
Enzymes [BR:gdi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GDI0710 (dadB)
Peptidoglycan biosynthesis and degradation proteins [BR:gdi01011]
 Precursor biosynthesis
  Racemase
   GDI0710 (dadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
complement(721767..722930)
Genome map
AA seq 387 aa AA seqDB search
MLTADPMPAAPSAWTGGILTIDLDAVAANYRILRDRVGPRTICGAAVKADAYGLGAARIV
PVLAEAGCHTFFVAHLAEGAAIRPLLGTDATIFVLNGAMPGTEAALHEHGLVPVLNSLEQ
IARWRDLARQAGRDLPAALQVDSGMSRFGLSDADVDALAARDGSLAGITPLLVMSHLACA
DEPAHPANHAQRAAFLRLRARLPAAPASLAASSGLFMGSDWHFDMVRPGAALYGINPTPG
WPNPMQPVVRLQARIVQTRWIGPGTAVGYGAAFIADRPSRIATLAVGYGDGFPRAAGGHG
HAVLPERPAAKLPIIGRISMDCLAVDVTDISDAPLDAGTALDLIGPHHSIDSAAAAAGTI
GYELLTGLGARYHRLYRDDRSRKGCNG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgcggacccgatgcccgccgccccttcggcctggacggggggcatcctgacg
atcgatctggacgcggtcgccgccaattaccgcatcctgcgcgaccgggtcggtccccgc
acgatatgcggcgcggcggtcaaggccgatgcgtacgggctgggcgcggcccgcatcgtg
cccgtcctggcggaagccgggtgccataccttcttcgtcgcgcacctggccgagggggct
gccatccggcccctgctgggcacggatgccacgattttcgtcctgaacggcgccatgccg
ggcaccgaagccgcgttgcacgaacacggactggtgccggtgctgaacagcctggaacag
atcgcgcgctggcgcgacctggcccggcaggccggcagggacctgcctgccgcgctgcag
gtcgatagcggcatgtcacgcttcggcctgtcggacgcggatgtggatgccctggcggcg
cgggacggttccctggccgggatcacgccgctgctggtcatgagccacctggcctgcgcc
gacgaacccgcccaccccgccaaccacgcgcagcgcgcggccttcctgcgcctgcgggcc
aggctgccggcggcgcccgccagcctggccgcgtcgtccggcctgttcatgggcagcgac
tggcatttcgacatggtgcgcccgggcgccgcgctgtacggcatcaatcccacgccgggc
tggccgaatccgatgcagccggtggtccgcctgcaggcgcgcatcgtgcagacgcgctgg
atcggccccgggacggcagtcggatacggcgcagccttcatcgccgaccggcccagccgg
atcgcgacgctggcggtggggtacggcgacggatttccccgcgccgcgggcggccacggc
catgcggtcctgcccgaacggccggcggcgaagctgccgatcatcggccggatttccatg
gattgcctggcggtggacgtaaccgacatcagcgacgcccccctggacgccggcacggcg
ctggacctgatcggtccgcatcattccatcgattccgccgccgctgccgccggaaccatc
ggctacgaactgctgacggggctgggcgcacggtatcatcgtctctatcgcgacgaccgg
tcgcggaaaggatgcaacgggtga

DBGET integrated database retrieval system