KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_1300Help
Entry
Gdia_1300         CDS       T00798                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Gdia_1300
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Gdia_1300
Enzymes [BR:gdj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Gdia_1300
Peptidoglycan biosynthesis and degradation proteins [BR:gdj01011]
 Precursor biosynthesis
  Racemase
   Gdia_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1451323..1452486
Genome map
AA seq 387 aa AA seqDB search
MLTADPMPAALSAWAGGILTIDLDAVAANYRILRDRVGPRTICGAAVKADAYGLGAARIV
PVLAEAGCRTFFVAHLAEGAAIRPLLGTDATIFVLNGAMPGTEAALHEHGLVPVLNSLEQ
IARWRDLARQAGRDLPAALQVDSGMSRFGLSDADVDALAARDGSLAGITPLLVMSHLACA
DEPAHPSNHAQRAAFLRLRARLPAAPASLAASSGLFMGSDWHFDMVRPGAALYGINPTPG
WPNPMQPVVRLQARIVQTRWIGPGTAVGYGAAFIADRPSRIATLAVGYGDGFPRAAGGHG
HAVLPERPAAKLPIIGRISMDCLAVDVTDIGDAPLDAGTALDLIGPHHSIDSAAAAAGTI
GYELLTGLGARYHRLYRDDRSRKGCNG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgcggacccgatgcccgccgccctttcggcctgggcggggggcatcctgacg
atcgatctggacgcggtcgccgccaattaccgcatcctgcgcgaccgggtcggtccccgc
acgatatgcggcgcggcggtcaaggccgatgcgtacgggctcggcgcggcccgcatcgtg
cccgtcctggcggaagccgggtgccgtaccttctttgtcgcgcacctggccgagggggct
gccatccggcccctgctgggcacggatgccacgattttcgtcctgaacggcgccatgccg
ggcaccgaagccgcgttgcacgaacacggactggtgccggtgctgaacagcctggaacag
atcgcgcgctggcgcgacctggcccggcaggccggcagggacctgcctgccgcgctgcag
gtcgatagcggcatgtcacgcttcggcctgtcggacgcggatgtggatgccctggcggcg
cgggacggttccctggccgggatcacgccgctgctggtcatgagccacctggcctgcgcc
gacgaacccgcccacccctccaaccacgcgcagcgcgcggccttcctgcgcctgcgggcc
aggctgccggcggcgcccgccagcctggccgcgtcgtccggcctgttcatgggcagcgac
tggcatttcgacatggtgcgcccgggcgccgcgctgtacggcatcaatcccacgccgggc
tggccgaatccgatgcagccggtggtccgcctgcaggcgcgcatcgtgcagacgcgctgg
atcggccccgggacggcagtcggatacggcgcagccttcatcgccgaccggcccagccgg
atcgcgacgctggcggtggggtacggcgacggatttccccgcgccgcgggcggccacggc
catgcggtcctgcccgaacggccggcggcgaagctgccgatcatcggccggatttccatg
gattgcctggcggtggacgtgaccgacatcggcgacgcccccctggacgccggcacggcg
ctggacctgatcggtccgcatcattccatcgattccgccgccgctgccgccggaaccatc
ggctacgaactgctgacggggctgggcgcacggtatcatcgtctctatcgcgacgaccgg
tcgcggaaaggatgcaacgggtga

DBGET integrated database retrieval system