KEGG   Geobacillus sp. 12AMOR1: GARCT_02441Help
Entry
GARCT_02441       CDS       T03966                                 

Gene name
sodA_2
Definition
(GenBank) Superoxide dismutase (Mn)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gea  Geobacillus sp. 12AMOR1
Brite
Enzymes [BR:gea01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GARCT_02441 (sodA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2400640..2401254)
Genome map
AA seq 204 aa AA seqDB search
MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHPDLQNKSLEELLSN
LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEPTGELADAINKKFGSFTAFKDEFS
KAAAGRFGSGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRPE
YIAAFWNIVNWDEVAKRYSEAKAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgaattgccagcattgccgtatccgtatgatgccctggagccgcacatcgac
aaagaaacgatgaacattcaccacacgaagcaccataacacatacgttacaaatttgaat
gcggcgcttgaaggacatccggatttgcaaaacaaatcgctcgaagaactgctcagcaat
ttggaagcccttccggaaagcatccgcacggcggtgcgcaacaacggcggcggccatgcg
aaccactcgcttttctggacgattttgtcgccaaatggcggcggcgagccgacgggtgag
ctggctgacgccatcaacaaaaaattcggcagcttcaccgcgttcaaagacgagttttcg
aaagcagcggccggccgtttcggttccggttgggcatggcttgtcgtgaacaacggcgag
ctggaaattacgagcacgccgaaccaagattcgccgattatggaaggcaaaacgccgatt
ctcggcttggacgtttgggagcatgcgtactacttgaaataccaaaaccgccgtccggaa
tacattgccgcattctggaacattgtcaactgggacgaagtggcgaaacggtacagcgaa
gcgaaagcgaagtaa

DBGET integrated database retrieval system