KEGG   Geobacillus sp. 12AMOR1: GARCT_02795Help
Entry
GARCT_02795       CDS       T03966                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00010  Glycolysis / Gluconeogenesis
gea00030  Pentose phosphate pathway
gea00051  Fructose and mannose metabolism
gea00052  Galactose metabolism
gea00680  Methane metabolism
gea01100  Metabolic pathways
gea01110  Biosynthesis of secondary metabolites
gea01120  Microbial metabolism in diverse environments
gea01130  Biosynthesis of antibiotics
gea01200  Carbon metabolism
gea01230  Biosynthesis of amino acids
gea03018  RNA degradation
Module
gea_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gea_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:gea00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GARCT_02795 (pfkA)
   00030 Pentose phosphate pathway
    GARCT_02795 (pfkA)
   00051 Fructose and mannose metabolism
    GARCT_02795 (pfkA)
   00052 Galactose metabolism
    GARCT_02795 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    GARCT_02795 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GARCT_02795 (pfkA)
Enzymes [BR:gea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GARCT_02795 (pfkA)
Protein phosphatases and associated proteins [BR:gea01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GARCT_02795 (pfkA)
Messenger RNA biogenesis [BR:gea03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GARCT_02795 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase PucR Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AKM20045
UniProt: A0A0G3Y031
LinkDB All DBs
Position
complement(2723835..2724794)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEAL
ANKHTIDQRMYALSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgcattggtgtgttgacaagcggcggcgactcgccgggaatgaatgcggccatt
cgcgcggttgtccgcaaagcgatttaccacggggtggaagtgtacggcgtttatcacggg
tatgccggactgatcgccggcaacattaaaaagctggaagtcggcgatgtcggggatatt
atccaccgtggcggcacgatactctatacggcccgctgtccggaatttaagacggaagaa
ggtcagaaaaaagggatcgagcagctgaaaaagcacggcattgaagggctggtcgtcatc
ggcggcgacggttcgtaccaaggggcgaaaaaactgaccgagcacggctttccgtgcgtc
ggcgtgccggggacgattgacaacgacattccgggcactgattttacgatcgggtttgac
acggcgctcaatacggtcattgatgccatcgacaaaatccgcgacacggcgacgtcgcac
gagcggacgtacgtcatcgaagtgatgggccgccatgccggcgacatcgccttatggtcg
gggctggccggcggggcggaaacgattttaattccggaagccgattatgatatgaacgac
gtcatcgcccgcttaaaacgcggccatgagcgcggcaaaaaacatagcatcatcatcgtg
gcggaaggggtcggaagcggcgtcgacttcggccggcaaatccaagaagcgaccggcttt
gagacgcgcgtgacggtgcttggccacgtgcagcgcggcgggtcgccgacggcgtttgac
cgcgtgctcgcgagccgcctcggcgcccgggcggtcgagctgctgcttgaaggaaaaggc
gggcgctgcgtcggcatccaaaacaaccagctcgtcgaccatgacatcgcggaggcgctg
gccaacaaacatacgatcgatcagcggatgtacgcattgtcgaaagaattgtccatttaa

DBGET integrated database retrieval system