KEGG   Geobacter sp. M18: GM18_3857Help
Entry
GM18_3857         CDS       T01421                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
geb  Geobacter sp. M18
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GM18_3857
Enzymes [BR:geb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GM18_3857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(4514193..4515512)
Genome map
AA seq 439 aa AA seqDB search
MQDVILHAFDWHYDDIAENAKKIAELGYGAILIAPPLYSDERGPEWWQRYQPKDYRVVRS
YLGGKKQLEQAIQALHASNVRVYADVVFNHMANEKSARNDPYNFPGDRELARYLSEAESF
ERDRLYGDLSVGLFCQRDFNPQGDICNWNDLHESQELWLSGLPDLDLNDWVVEQQKACLS
ALNRLGFDGYRIDAIKHLPYDHIARVFQTEILNGKFVFGEALTCNDHEECLFLWPLLYIT
SISFYDFPLHETLRRTFSTTGSMRELVNPAANGQALHWSRAVTFSITHDIPNNDGFRWQM
LDPQDEFLANVYIMGRDGGIPLVFSDHNQSAARYNSDRNRWNEAWSRQDTAGMIAFHNAV
HGTPQRPLFEHDGFIVFARGDRGIVAINKTDEWQHPRIWTNGLKQGRYHCMIHGYDMQVS
GEWFDLGIPPRQAQMWLGN
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgtgattctccacgccttcgactggcactatgatgatatcgccgagaacgcc
aagaagatcgcagagcttggctatggggcaatactcattgctccacctctctacagtgac
gagcgaggtcctgaatggtggcagcgctatcagccgaaggattatcgcgtggtcagatcg
tatctgggtggcaagaaacagttggagcaggcgatccaggctttgcatgcctccaatgtg
cgggtttatgccgatgtggtcttcaaccacatggcaaatgaaaaaagtgcccgcaacgat
ccttacaattttcccggtgacagagagttggcgcgctacctcagcgaggcggagtccttt
gagcgcgacaggctctacggtgatctgagcgtggggctgttctgtcagcgggatttcaac
ccgcagggtgacatatgcaactggaacgacctgcacgaatcccaggaactctggctctcc
gggcttccggacctcgatctgaacgactgggtggtcgaacagcagaaggcttgcctctcc
gccctgaaccgcctaggcttcgacggctaccgtatcgacgctatcaagcacctcccatat
gaccacatcgcccgcgttttccagacggagatcctgaacggcaaattcgtcttcggcgaa
gcgctcacctgcaacgatcacgaagaatgcctgttcctctggcccctgctgtacatcacc
agtatctctttctatgactttccattgcatgaaactctgcgccgcaccttctcgactacg
gggagcatgcgcgagttagtcaaccccgcagccaatgggcaagcattgcattggagccgc
gcagtgaccttcagcataacccatgacattcccaacaacgacgggtttcggtggcagatg
ctggatcctcaggacgagttccttgccaacgtctatatcatgggccgtgacggcggcatc
ccgctggtcttttccgaccacaaccagagcgccgccagatacaattcggatagaaaccgc
tggaacgaggcctggagcaggcaagataccgccgggatgatcgcttttcacaacgcggtt
catgggacaccgcaaagaccgcttttcgagcatgacggcttcatcgtttttgctcgcggc
gaccgcggcattgtggcgataaacaaaaccgacgagtggcagcatccgcgcatctggacc
aatggactcaagcaagggcgttaccactgcatgatccatggctacgacatgcaggtcagc
ggtgagtggttcgaccttggcatccccccacgccaggcgcagatgtggctggggaactaa

DBGET integrated database retrieval system