KEGG   Geminocystis sp. NIES-3708: GM3708_3299Help
Entry
GM3708_3299       CDS       T04168                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gee  Geminocystis sp. NIES-3708
Brite
Enzymes [BR:gee01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GM3708_3299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3658090..3658695)
Genome map
AA seq 201 aa AA seqDB search
MAYQLPTLPFDYTALEPCISKSTLEFHHDKHHAAYVNNFNNAVAGTDLDSKSLEEVIKIT
ATNPSQAGIFNNAAQAWNHSFYWQSIKPNGGGTPSGALADKIDADFGSFDKFVEAFKTAG
ATQFGSGWAWLVLDNGTLKVTKTGNADNPLTAGQIPLLTMDVWEHAYYLDYQNKRPDYIS
DFLSKLVNWDFVAENFAKATA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcaattaccaactcttcctttcgattacaccgcattagagccttgtatctct
aaaagtaccttagaatttcatcatgacaaacatcacgctgcctatgtaaataacttcaat
aatgcagtcgcaggtacagatttagactctaaatcccttgaagaagtcattaaaatcacg
gctactaaccccagtcaggctggtatttttaataatgctgctcaagcatggaatcacagt
ttttattggcagtctattaaacctaatggtggtggtactcctagtggtgcattagctgat
aaaattgatgctgatttcggtagttttgacaagtttgtagaggctttcaaaacggctggt
gctactcagtttggtagtggttgggcatggttagtattagataatggtactttaaaagtc
actaaaactggtaatgccgataatcccttaaccgctgggcaaattcctttattaacaatg
gatgtatgggaacacgcttactatttagattatcaaaataaacgccctgattacatcagt
gattttctaagcaaattagttaattgggattttgttgcggaaaattttgctaaggcaacg
gcttaa

DBGET integrated database retrieval system