KEGG   Geobacillus sp. LC300: IB49_06545Help
Entry
IB49_06545        CDS       T04018                                 

Definition
(GenBank) transglutaminase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
gel  Geobacillus sp. LC300
Brite
Enzymes [BR:gel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     IB49_06545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1222997..1223818
Genome map
AA seq 273 aa AA seqDB search
MIRILSSPSGFHVSGSSSLPPNEQRILHALVSSPELYTYPNEQQLLFEIKLRSQIVQASV
DLAKSRAQFAIFRFSRCNSQFWLRDERGGFQLRPDVLPSDAINDIFVNSELYAFECATAI
VIVFYKAVLEGIDVSAFNRLFANLLLYDWHTDKDLGIETKKGEHFLPGDCLYFKNPDVDP
LTPQWQGENTIYLGDGLFYGHGIGIETADGIIAALNRRRKQWATKSAYLLPHITQMNFAY
LSQFARRFDELRLPLGRLPWIAGTLGSAAFLYR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgcatcttgtcatctccgtccggttttcacgtttccggctcgtcctcgcttccg
ccgaatgaacagcgcattttgcacgcccttgtgtcttcccctgaactatatacgtatccg
aacgaacagcaactgctgtttgaaatcaagcttcgcagccagatcgttcaagcctcggtg
gacttggcgaaaagccgggcgcagtttgccattttccgtttttcgcgctgcaacagccag
ttctggctgcgggatgagcgcggggggtttcagcttcggccagacgttcttccatcggac
gccatcaatgatatttttgtcaacagcgaactgtacgcctttgagtgcgcgacggcgatc
gtcatcgttttttataaagcggtgcttgaagggattgacgtgtcggcgttcaatcgtttg
tttgccaatttgctgctgtatgactggcatacggacaaagacctcggtatcgaaacgaaa
aagggagaacactttctccccggggactgcctttattttaaaaacccggacgttgatccg
ctgacgccgcaatggcaaggggagaacacgatctatttgggcgatggcttgttttacgga
cacggcatcggcatcgagacagcggacggcatcatcgccgccctcaaccggaggcggaag
cagtgggcgacgaaatccgcctatcttcttcctcatattacacaaatgaacttcgcttat
ttatcccaattcgcccgccgcttcgacgaactccgcctgccgctcggccgtctgccatgg
atcgccgggacgttagggtccgctgctttcttgtatcgttag

DBGET integrated database retrieval system