KEGG   Geobacillus sp. LC300: IB49_11375Help
Entry
IB49_11375        CDS       T04018                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gel  Geobacillus sp. LC300
Pathway
gel00473  D-Alanine metabolism
gel00550  Peptidoglycan biosynthesis
gel01100  Metabolic pathways
gel01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gel00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    IB49_11375 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IB49_11375 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    IB49_11375 (ddl)
Enzymes [BR:gel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     IB49_11375 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:gel01011]
 Precursor biosynthesis
  Amino acid ligase
   IB49_11375 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: AKU26936
UniProt: A0A0K1KCI7
LinkDB All DBs
Position
2132019..2133113
Genome map
AA seq 364 aa AA seqDB search
MKTRVGVLYGGKSPEHQVSLSTAMAVMNAIDPHKFDVIPIYITPQGQWIKGKRLTGPVKE
VKQLQFTSTATAMIPVSLNQVPASESSSADSEETIDVIFPLLHGPNGEDGTVQGLLEMLN
LPYVGNGVLASAVGMDKVIMKNLFAQAGLRQAKYVAVTKYDWQKSGEAVYDRIERELGYP
CFVKPANAGSSVGISKCKQRGDLHKAFAEAFKYDRKIIIEEAIVGREIEIGVIGNDEPIC
SVVGEIVPKKEFYDYEAKYEDGQTELIIPADVTKEQYETIKQMAITAFQALDLSGLARVD
FFLAEDGAVYINEVNTMPGFTPYSMFPLLWQHSGVPYPELIERLIALALERHQEKQTITY
TFEK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgagagtcggagtgttgtatggcgggaagtcgccggagcatcaagtatcgttg
tcaacggcgatggcagtgatgaacgccatcgatccccataaatttgatgtgattccgatt
tacattactccacaagggcagtggattaaaggaaagcgattgaccggaccggtcaaagaa
gtgaaacagctgcagttcacgtcgacagcgacggccatgatcccggtatctttaaaccag
gtgccggcgtcggaatcgtcgtctgcggacagcgaggaaacgattgacgtcatcttcccg
cttttgcatgggccgaacggcgaagacggaactgtgcaaggactgctcgaaatgttaaac
ctcccgtacgtaggcaacggtgtgcttgcctcggccgtcggcatggataaagtgattatg
aaaaacttgtttgcccaagccgggctgcgccaggcgaaatatgtggcggtgaccaaatat
gactggcaaaaaagcggggaagccgtttacgaccggatcgaacgagagcttggctacccg
tgctttgtcaagccagccaacgccggttcgagcgtcggcatttccaaatgcaagcagcgc
ggcgatttgcacaaggcgtttgccgaagcgtttaagtatgaccggaaaatcatcattgaa
gaagcgatcgtcggccgggagatcgagatcggcgtcatcggcaatgatgaaccgatttgt
tcggtcgtcggagaaattgtgccaaaaaaggaattttacgactatgaagcgaaatacgaa
gacgggcaaaccgaattgatcatcccagcggacgtaacgaaagaacagtatgagacgatc
aaacaaatggccattacggcgtttcaggcgctggatttgtctggacttgcgcgcgtcgat
tttttcctcgccgaagatggcgctgtttatatcaacgaagtgaacacgatgccaggcttt
acgccatacagcatgttcccgcttctttggcagcacagcggcgtgccgtatccggaactg
atcgagcgcctcattgcgctggcgttggaacggcatcaagaaaagcagacgatcacgtac
acatttgaaaaataa

DBGET integrated database retrieval system