KEGG   Geobacter daltonii FRC-32: Geob_3627Help
Entry
Geob_3627         CDS       T00846                                 

Gene name
tuf-1
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
geo  Geobacter daltonii FRC-32
Brite
Translation factors [BR:geo03012]
 Eukaryotic Type
  Elongation factors
   Geob_3627 (tuf-1)
 Prokaryotic Type
   Geob_3627 (tuf-1)
Mitochondrial biogenesis [BR:geo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Geob_3627 (tuf-1)
Exosome [BR:geo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Geob_3627 (tuf-1)
  Exosomal proteins of breast cancer cells
   Geob_3627 (tuf-1)
  Exosomal proteins of colorectal cancer cells
   Geob_3627 (tuf-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(4016706..4017896)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLAGKGQAEFKAFDQIDNAPEERERG
ITIATAHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDEELLELVELEIRELLSSYDFPGDDIPIIKGSALQALN
GEQGELAEPAIMKLMEAVDSYIPEPQRAIDRPFLMPVEDVFSISGRGTVATGRVERGIVK
VGEEVEIVGMKATSKTTVTGVEMFRKLLDEGRAGDNIGALLRGVKREDIERGQVLAKPGS
ITPHTKFKAEAYILTKEEGGRHTPFFNGYRPQFYFRTTDVTGIVELAAGTEMVMPGDNVA
VQVNLITPIAMDEGLRFAIREGGRTVGAGVVSSIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagcaaaattcgaaagaaccaaaccgcatgtaaacataggcaccatcgggcac
gttgaccacggcaagaccaccctgaccgccgccatcaccaaagtactggcaggcaaaggc
caggcagaattcaaagccttcgaccagatcgacaatgcccccgaagagcgtgagcgtggt
atcaccatcgccaccgcccatgttgaatatgaaaccgacaagcgtcactatgcccatgtt
gactgcccgggccacgccgactacgtaaagaacatgatcaccggagcagcgcagatggat
ggcgccatcctggtcgtatccgcagccgacggtccaatgccccagactcgtgagcacatt
ctgctcgcccgtcaggtaggcgtaccttacatagtagtattcctcaacaaagccgacatg
gtcgacgacgaagagcttctcgaactggtagaactcgagattcgcgaactgctctcctcc
tacgacttccccggcgacgacatccccatcatcaaaggctccgcccttcaggcactgaac
ggcgagcagggcgaactggccgagcccgccatcatgaagctcatggaagccgtagacagc
tacatcccagagccacagcgcgccatcgaccgtccgttcctcatgcccgtcgaagacgta
ttctccatctccggccgtggaaccgtagcaaccggccgtgtagaaagaggcatcgtcaag
gtcggcgaagaagtagagatcgtcggaatgaaggcaacctccaagaccaccgtaaccggc
gtagaaatgttcaggaagcttttggatgaaggccgtgccggcgacaacatcggcgctctg
cttcgtggcgtcaagcgtgaagacattgagcgtggccaggtactcgccaagcccggttca
atcaccccgcacaccaaattcaaggcagaagcctacatcctgaccaaagaagaaggtgga
cgacacaccccgttcttcaacggctatcgtccccagttctacttccgcaccaccgacgtg
accggcatagtagaacttgccgccggcaccgagatggtaatgcccggcgacaacgtagca
gtacaagtgaacctgatcaccccaatcgccatggacgaaggacttcgcttcgccatccgt
gagggcggccgcactgtcggcgccggggttgtcagctctattatcgaataa

DBGET integrated database retrieval system