KEGG   Geosporobacter ferrireducens: Gferi_05440Help
Entry
Gferi_05440       CDS       T04493                                 

Definition
(GenBank) protein-glutamine gamma-glutamyltransferase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
gfe  Geosporobacter ferrireducens
Brite
Enzymes [BR:gfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     Gferi_05440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1072337..1073101
Genome map
AA seq 254 aa AA seqDB search
MTIYAGNTTLPNDFVNQYPTNSVERKVIEILSSSNQVYRYQSLDHFKFELELRANVVSAS
RELFYSGLSFRTFRRSVCNPAYWNRDEDGGFSTKEGVPPSEAIRDIFRNGSRYGTECATA
IVIVYFKAVLNVFPDEIFNRLFPRINLMNWQNLDNNLGISYFRNPIDYLPGDCRYVRNPD
VNPSTPEWQGENAIDLGNGFYYGHGIGIKTIDGIIAALNQNRRPGATESAYLMNSVNRLD
FVRLASLYNRFVSV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaccatatatgcaggtaatactacccttccaaacgattttgtcaatcagtatccaacc
aatagtgtagaaagaaaagtcattgaaatactatcttccagcaatcaagtttaccggtac
caatctttagatcactttaaatttgaactagagctacgggcaaatgtggtgagtgcttct
agggaactcttttatagcggcctttcttttcgtacttttcgtagatccgtgtgtaatcca
gcttattggaaccgcgatgaagacggcggcttttcaacaaaagaaggagttcctccatcg
gaagccattcgagatattttcagaaacggatccagatatggaaccgaatgtgctacggca
attgtcattgtttactttaaagccgttctaaatgtatttcctgatgaaatctttaataga
ctattccctagaataaacttgatgaattggcagaacttagataacaatcttggtattagc
tattttagaaaccctatagattacttgcccggcgactgtagatatgttagaaatccagat
gtaaacccttcgactcctgaatggcaaggagaaaatgcaattgatttgggtaacggattt
tattatggccatgggattggcataaagacaatagatggaatcattgccgctttaaatcaa
aatagaagaccgggcgctaccgaatctgcatatttgatgaattctgttaatcgtttagac
tttgtgcgtctcgcttctctgtataatcgttttgtttctgtataa

DBGET integrated database retrieval system