KEGG   Geospiza fortis (medium ground-finch): 102032473Help
Entry
102032473         CDS       T03755                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
gfr  Geospiza fortis (medium ground-finch)
Brite
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102032473 (ACE)
Peptidases [BR:gfr01002]
 Metallo Peptidases
  Family M2
   102032473 (ACE)
Exosome [BR:gfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102032473 (ACE)
CD molecules [BR:gfr04090]
 Proteins
  102032473 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1278 aa AA seqDB search
MPAALGLLLWLSLAGALRPDLEPPQHNSTEAGAARFASDYNSTAEIVLFNSVSASWNYNT
NLTDENAALQVTASLEEQNFTELWGKKAKELYGDKWNNFSDPQLRKIIGSIQTLGPSNLP
LEMREQYNTILSDMDKIYSTAKVCLPNGTCWDLEPDLSDIMATSRSYKKLLFAWEGWHNA
AGNPLRPKYQEFVQLSNAAYAKDGFNDTGSYWRSWYDSDSFEKDLEHIYNQLEPLYLNLH
AFVRRKLYDRYGPKYINLKGPIPAHLLGNMWAQQWNNIYDLMIPYPEKPNLDVTSTMVQQ
GWNATHMFRVSEEFFTSLGLLEMPPEFWKESMLEKPTDGREVVCHASAWDFYNRKDFRIK
QCTSVTMEQLFTVHHEMGHIQYYLQYKDQPVSFRSGANPGFHEAIGDVLSLSVSTPSHLK
KIGLLSNATEDEESNINYLLKMALEKIAFLPFGYLIDQWRWNVFSGRTPPSRYNYDWWYL
RTKYQGICAPISRNESNFDPGAKYHIPGNTPYIRYFVSFVLQFQFHKALCQAANHTGSLH
TCDIYKSKEAGDKLREVLKAGSSKSWQEILLNLTGTGQMDAEPLLEYFSPVTKWLQEQNN
KTNEVLGWPEFDWRPPVPEGYPEGIDKIADEAQAKEFLSEYNSTAEEVWNAYTEASWAYN
TNITDHNKEIMLEKNLAMSKHTLEYGMRARQFDTSDFQDQSVTRILKKLSVIERAALPEN
ELKEYNTLLSDMETTYSVAKVCRENKTCHPLDPDLTDIMATSRDYDELLFAWKGWRDASG
KKMRNNYKRYVELSNKAAMLNGYTDNGAYWRSLYETPTFEEDLERLYQQLQPLYLNLHAY
VRRALYKKYGAEYINLKGPIPAHLLGNMWAQSWSNIFDLVVPFPDATKVDATPAMKNQGW
TPKRMFEESDHFFTSLGLIPMPQEFWDKSMIEKPSDGREVVCHASAWDFYNRKDFRIKQC
TVVNMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVMALSVSTPKHLHSI
NLLDQVMENEESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIKEDEYNKEWWNLRM
KYQGLCPPALRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCDAASHKGPLHTC
DIYQSKEAGKILGDALKLGFSKPWPEAMQLITGQPNMSAEALMSYFEPLMTWLEKENQKN
GEVLGWPEYSWTPYTGMQGSANTTDFLGMSLTKSQATAGGWVLLALALIFLITTIFFSVK
FFLVRRKTFTSISEMELK
NT seq 3837 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcggcgctggggctgctgctctggctgagcctcgcaggtgcccttcgccccgac
ctcgagcccccccagcacaacagcaccgaggcaggggccgcccgcttcgcctcggactac
aacagcacggccgagatcgtcctcttcaacagcgtctcggccagctggaattacaacacc
aacctgacggacgagaatgctgctctgcaggtcacggcatcactggaggagcagaacttc
acagagctttgggggaagaaagccaaggaactctatggcgacaagtggaataacttcagt
gacccccagctgaggaaaatcattggatcaatccagaccttgggaccctccaacctgccc
ctggagatgagagagcagtacaacaccatcctcagtgacatggacaaaatctactccacg
gccaaggtgtgcctgcccaatggcacctgctgggatctggagccagacctgtcggacatc
atggccacgtcccgcagctacaagaagctgctgtttgcctgggagggctggcacaacgcc
gcggggaacccgctgcgccccaagtaccaggagttcgtgcagctcagcaacgccgcctac
gccaaggatggattcaatgacacaggcagctactggcgctcctggtacgactcagactcc
tttgagaaggacctggagcacatctacaaccagctggagccactctacctcaacctgcac
gccttcgtccggaggaagctgtacgaccgctatgggcccaaatacatcaacctgaagggt
cccatccccgctcacctcctggggaacatgtgggctcagcagtggaacaacatctatgac
ctgatgatcccctaccctgagaaacccaaccttgatgtcacgagcaccatggtgcagcag
ggctggaatgccactcacatgttccgggtctcagaggagttcttcacctccctggggctt
ctggagatgccccctgaattctggaaggagtccatgctggaaaagccgacagatgggcgg
gaggtggtgtgtcatgcctcagcctgggacttctacaaccgcaaggacttcaggatcaag
cagtgcacatcggtgaccatggagcagctgttcacagtgcaccacgagatgggccacatc
cagtactacctgcaatacaaggaccagcccgtgtccttccgcagcggggccaaccctggc
ttccacgaggccatcggggatgtcctgtccctctctgtctccacccccagccacctcaag
aaaatcggtctcctcagcaacgctactgaggatgaagagagcaatatcaactacctgctg
aagatggccctggagaagattgccttcctgccctttggctacctcattgaccagtggcgc
tggaatgtgttcagtggccgcacgccgccgagccgctacaactacgactggtggtacctg
agaaccaaataccagggcatctgcgccccgatttcaaggaatgagagcaactttgaccct
ggagcaaagtaccacatcccggggaacactccttacatcaggtactttgtgagcttcgtc
ctccagttccagtttcacaaggcactgtgccaggcagccaaccacaccggttccctgcac
acctgtgacatctacaagtccaaagaggctggagacaaactcagagaagtgttgaaagct
gggtcctcgaagtcttggcaggaaatcctcttgaatctcactggcacgggtcagatggat
gctgaaccccttctggagtacttcagccctgtcaccaagtggcttcaggagcagaacaac
aagaccaatgaggtgctgggctggcctgagtttgactggcgtccccctgtccctgaaggc
taccctgaaggcattgacaaaatagcagatgaggcacaagctaaagagttcttgtccgag
tacaacagcacagctgaggaagtgtggaatgcctacaccgaggcctcctgggcctacaac
accaacatcactgaccataacaaggagatcatgctggagaagaacttggccatgtccaag
cacaccctggagtacggcatgagggccaggcagttcgacacctccgatttccaggaccaa
agtgtcacccgcatcctcaagaagctgagcgtcattgagagggcagccttacctgagaat
gagctgaaggagtataacaccctcctctcagacatggagaccacctacagtgtggccaag
gtctgcagagagaacaaaacctgtcacccactggatcctgacctcacagacatcatggcc
acctctcgggactatgacgagctcctctttgcctggaagggctggcgggatgcttctggg
aagaaaatgaggaacaactacaagagatatgtggagctgagcaacaaggcagccatgctc
aatggctacacggacaatggggcctactggagatccctgtatgagacacccaccttcgag
gaagatctggagaggctgtatcagcagctgcagcccctgtacctcaacctgcatgcttat
gtacgccgagccctctacaaaaagtatggtgcagagtacataaacctgaagggtcccatc
cctgcccatctgctaggcaacatgtgggctcagtcatggtccaacattttcgacctggtg
gtacctttcccagatgccaccaaggtggatgccaccccggccatgaaaaaccagggctgg
acacccaagagaatgtttgaagagtcagaccatttcttcacctctctgggcctcatcccg
atgccacaggagttctgggacaagtccatgatcgagaagccatcggacgggcgggaggtg
gtgtgccacgcctcagcctgggatttctacaaccgcaaggacttcaggatcaagcagtgc
accgtggtgaacatggacgacctcatcacagtgcaccacgagatgggccacgtccagtac
ttcctgcagtacaaggaccagcctgtctccttccgtgacggggccaaccctggcttccac
gaggccattggggatgtcatggccttgtctgtctccacccccaaacacctccatagcatc
aatctgctggaccaagtcatggaaaacgaagaaagtgatattaactacctgatgagcatc
gccctggacaaaattgccttcctgcccttcgggtacctcatggaccagtggcgctggaag
gtgtttgatgggcggatcaaggaggacgagtacaacaaggagtggtggaacctcaggatg
aagtaccagggcttgtgcccaccagcactgaggtctgaagatgactttgaccccggggca
aagtttcacattcctgccaacgtcccttacattaggtacttcgtcagctttgtgatccag
ttccagttccaccaggcactctgtgatgcagccagccacaagggtcccctgcacacctgc
gacatctaccagtccaaggaggctgggaagatcttgggggatgccctgaagctgggtttc
agcaagccatggcccgaagccatgcagctcatcacaggacagcccaacatgtcagcagag
gccctgatgagctactttgagccactcatgacgtggctggagaaagagaaccagaagaac
ggggaggtcctgggctggcccgaatacagctggactccttacacaggtatgcagggctca
gccaacacaactgatttcctgggaatgtccctgaccaaaagtcaagccacggctgggggc
tgggtcctgctcgccctggcactcatcttcctgatcaccaccatcttcttcagtgtcaag
ttcttcttagtcaggagaaagaccttcacatccatctcagaaatggagctgaaataa

DBGET integrated database retrieval system