KEGG   Geospiza fortis (medium ground-finch): 102034686Help
Entry
102034686         CDS       T03755                                 

Gene name
PCSK2
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 2
  KO
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
gfr  Geospiza fortis (medium ground-finch)
Brite
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     102034686 (PCSK2)
Peptidases [BR:gfr01002]
 Serine Peptidases
  Family S8: subtilisin family
   102034686 (PCSK2)
Chaperones and folding catalysts [BR:gfr03110]
 Intramolecular chaperones
  Subtilisin family
   102034686 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 620 aa AA seqDB search
MSVFCTLRSIHETSRKPFRHDGDQAEAERVAAEHGFGGVRKLPFLESGYFFYHNGLAKAR
RRRSLQHKLRLEKDSRVRKVVQQEGFIRRKRGYRDINDIDIIMNDPLFTKQWYLINTGQA
DGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAKASYDFSSNDPYPYP
RYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHM
PQVIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCN
CDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKRNPEAGVATTDLYGNCTL
RHSGTSAAAPEAAGVFALALEANLHLTWRDMQHLTVLTSKRNQLHDEVHRWRRNGVGLEF
NHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSIQEPEKIPPSGKLFLTLTTDACEGKE
NFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTH
TWGEDPRGTWALEIGFVGSQPQRGVLKEWTLMLHGTQSAPYIDQIVKDYQSKLAMSKKEE
LEEELDEAVERSLKSILSKK
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttttgcaccctgagatcaatccacgaaacatcacgaaagccgttccggcac
gacggggaccaggcggaggccgagcgggtagcggcggagcacggcttcggtggggtgcgg
aagctcccttttttagaatctggatactttttttatcacaatggtcttgctaaagccagg
agaagacgcagccttcaacacaagcttcgtctggaaaaggactccagggtgaggaaagtt
gtgcaacaggagggattcatccgaaggaagcgaggatatagagacatcaatgacattgac
atcatcatgaatgatcctttatttacaaagcagtggtacctgattaacactggtcaagca
gatgggactcctggacttgaccttaatgtagctgaagcatgggagctgggatacacaggg
aagggagtaaccataggaattatggatgatggaattgattatctgcatccagatcttgca
tcaaactacaatgccaaagccagctatgacttcagcagcaatgatccctacccctatccc
cgctatacagatgactggtttaacagccacgggacaaggtgtgcaggagaggtgtctgct
gctgccaacaacaacatctgtggtgtgggagttgcgtacaattccaaagtggcaggtatt
cgaatgctcgaccagccgtttatgacagacattattgaggcttcctccatcagtcatatg
cctcaagtcatagatatatatagtgccagctggggaccaactgataatgggaagactgtg
gatggacctagagagttaacgctgcaagcaatggcagatggtgtgaataagggccggggt
ggaaaaggcagtatctatgtctgggcctctggagatggaggcagctatgatgactgtaac
tgtgatggttatgcatcgagcatgtggacaatctccatcaattctgccataaatgatgga
cggacagctctgtatgatgaaagctgctcttcaaccttagcctccacctttagtaatggg
aggaagagaaatccagaggctggtgtggctacaacagatttgtatggcaactgcaccctg
cgtcattcaggcacgtctgcagctgcccctgaagcagccggagtgttcgccctggccctg
gaggctaacttgcatctgacatggagagacatgcagcatctgacagtgctcacctccaag
aggaaccagcttcatgatgaggttcacaggtggcgtaggaatggcgttggactggagttc
aaccatttgtttggctatggtgtcctagatgcaggagccatggttaagatggcaaaagac
tggaagactgttcctgagagattccattgtgttggagggtcaatacaggaacctgaaaag
ataccaccaagtggcaaactgttcctcacactgacaactgacgcatgtgaggggaaggag
aactttgtccggtaccttgaacatgtgcaggcagttataactgtgaattccactcggcga
ggagatctcaacatcaacatgacctcaccaatgggaacaaagtccattttgctgagccgg
cgccccagggatgatgactccaaggtgggttttgacaaatggcctttcatgaccactcac
acttggggagaagacccccgaggcacctgggctctggagattgggtttgttggcagccag
ccccagcggggtgtgctgaaggagtggacactgatgttgcatgggactcagagtgcaccg
tatatagaccaaatcgtaaaagattatcagtccaagctggccatgtccaagaaggaagag
ctggaagaagagttagatgaagcagtggagagaagcctgaagagtatactgagcaagaag
tag

DBGET integrated database retrieval system