KEGG   Geospiza fortis (medium ground-finch): 102040279Help
Entry
102040279         CDS       T03755                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
FoxO signaling pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:gfr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    102040279 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    102040279 (SOD2)
Enzymes [BR:gfr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102040279 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 249 aa AA seqDB search
MSKKMKKHCSRADRPAGPASLLSSWPLSCRMTNARSSAKLVAPLGCLVSRQKHTLPDLPY
DYAALEPHINAEIMQLHHSKHHATYVNNLNVAEEKYKEALAKGDVTTQVSLQPALKFNGG
GHINHSIFWTNLSPNGGGEPKGELMEAIKRDFGSFANFKEKLTAVSVGVQGSGWGWLGYN
KEQGRLQIAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENV
SSRYATCKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagatgaaaaagcactgttcaagagctgaccgccctgccggcccggcgagt
ctcctctcgtcgtggcccttgtcgtgtcgcatgacgaatgcgagaagcagtgccaagttg
gtagcacccttggggtgcttggtttctaggcaaaagcacacgcttcctgacttgccatat
gactatgctgctctggaacctcatattaatgcagagatcatgcagctgcaccacagcaag
catcatgccacctacgtgaacaacctgaatgttgccgaggagaagtacaaggaggcactg
gcaaaaggtgatgttacaactcaggtgtcacttcagcctgcactgaagttcaatggtggg
ggtcatatcaatcacagcatcttctggacaaacctttctcctaatggaggaggagaacct
aaaggagaattgatggaagccatcaagcgtgactttggttcttttgcaaacttcaaggag
aagctgacagctgtatcagttggtgtccaaggatcaggctgggggtggcttggctataac
aaggagcaggggcgcctacagatagcagcttgtgcaaatcaggaccctttgcaaggaaca
acaggtctcattcctttgctaggcattgatgtatgggaacatgcttattatcttcagtat
aaaaatgttcgacctgattatttgaaagccatctggaatgtgatcaactgggagaatgta
tcttcaagatacgcaacttgcaaaaagtag

DBGET integrated database retrieval system